Recombinant Full Length Human BOD1 Protein, GST-tagged

Cat.No. : BOD1-4600HF
Product Overview : Human FAM44B full-length ORF ( NP_612378.1, 1 a.a. - 185 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : BOD1 (Biorientation Of Chromosomes In Cell Division 1) is a Protein Coding gene. Diseases associated with BOD1 include Myoma. An important paralog of this gene is BOD1L2.
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 45.6 kDa
Protein length : 185 amino acids
AA Sequence : MADGGGGGGTGAVGGGGTSQASAGAATGATGASGGGGPINPASLPPGDPQLIALIVEQLKSRGLFDSFRRDCLADVDTKPAYQNLRQKVDNFVSTHLDKQEWNPTMNKNQLRNGLRQSVVQSGMLEAGVDRIISQVVDPKLNHIFRPQIERAIHEFLAAQKKAAVPAPPPEPEGQDPPAPSQDTS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BOD1 biorientation of chromosomes in cell division 1 [ Homo sapiens (human) ]
Official Symbol BOD1
Synonyms BOD1; biorientation of chromosomes in cell division 1; Biorientation Of Chromosomes In Cell Division 1; Family With Sequence Similarity 44, Member B; Biorientation Defective 1; FAM44B; Biorientation Of Chromosomes In Cell Division Protein 1; Biorientation Defective Protein 1; Protein FAM44B; biorientation of chromosomes in cell division protein 1; biorientation defective 1; family with sequence similarity 44, member B
Gene ID 91272
mRNA Refseq NM_001159651
Protein Refseq NP_001153123
MIM 616745
UniProt ID Q96IK1

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BOD1 Products

Required fields are marked with *

My Review for All BOD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon