Recombinant Full Length Human BOD1 Protein, GST-tagged

• Cat.No.: BOD1-4600HF
• Product Overview: Human FAM44B full-length ORF ( NP_612378.1, 1 a.a. - 185 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: BOD1 (Biorientation Of Chromosomes In Cell Division 1) is a Protein Coding gene. Diseases associated with BOD1 include Myoma. An important paralog of this gene is BOD1L2.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 45.6 kDa
• Protein length: 185 amino acids
• AA Sequence: MADGGGGGGTGAVGGGGTSQASAGAATGATGASGGGGPINPASLPPGDPQLIALIVEQLKSRGLFDSFRRDCLADVDTKPAYQNLRQKVDNFVSTHLDKQEWNPTMNKNQLRNGLRQSVVQSGMLEAGVDRIISQVVDPKLNHIFRPQIERAIHEFLAAQKKAAVPAPPPEPEGQDPPAPSQDTS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BOD1 biorientation of chromosomes in cell division 1 [ Homo sapiens (human) ]
• Official Symbol: BOD1
• Synonyms: BOD1; biorientation of chromosomes in cell division 1; Biorientation Of Chromosomes In Cell Division 1; Family With Sequence Similarity 44, Member B; Biorientation Defective 1; FAM44B; Biorientation Of Chromosomes In Cell Division Protein 1; Biorientation Defective Protein 1; Protein FAM44B; biorientation of chromosomes in cell division protein 1; biorientation defective 1; family with sequence similarity 44, member B
• Gene ID: 91272
• mRNA Refseq: NM_001159651
• Protein Refseq: NP_001153123
• MIM: 616745
• UniProt ID: Q96IK1