Recombinant Full Length Human BMP5 Protein, GST-tagged
Cat.No. : | BMP5-1726HF |
Product Overview : | Human BMP5 full-length ORF ( NP_066551.1, 1 a.a. - 454 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 454 amino acids |
Description : | This gene encodes a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. These proteins are synthesized as prepropeptides, cleaved, and then processed into dimeric proteins. This protein may act as an important signaling molecule within the trabecular meshwork and optic nerve head, and may play a potential role in glaucoma pathogenesis. This gene is differentially regulated during the formation of various tumors. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 78.1 kDa |
AA Sequence : | MHLTVFLLKGIVGFLWSCWVLVGYAKGGLGDNHVHSSFIYRRLRNHERREIQREILSILGLPHRPRPFSPGKQASSAPLFMLDLYNAMTNEENPEESEYSVRASLAEETRGARKGYPASPNGYPRRIQLSRTTPLTTQSPPLASLHDTNFLNDADMVMSFVNLVERDKDFSHQRRHYKEFRFDLTQIPHGEAVTAAEFRIYKDRSNNRFENETIKISIYQIIKEYTNRDADLFLLDTRKAQALDVGWLVFDITVTSNHWVINPQNNLGLQLCAETGDGRSINVKSAGLVGRQGPQSKQPFMVAFFKASEVLLRSVRAANKRKNQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCAPTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BMP5 bone morphogenetic protein 5 [ Homo sapiens ] |
Official Symbol | BMP5 |
Synonyms | BMP5; bone morphogenetic protein 5; BMP-5; MGC34244 |
Gene ID | 653 |
mRNA Refseq | NM_021073 |
Protein Refseq | NP_066551 |
MIM | 112265 |
UniProt ID | P22003 |
◆ Recombinant Proteins | ||
BMP5-11H | Recombinant Human Bone Morphogenetic Protein 5 | +Inquiry |
BMP5-26H | Recombinant Human Bone Morphogenetic Protein 5 | +Inquiry |
BMP5-27H | Active Recombinant Human Bone Morphogenetic Protein 5 | +Inquiry |
BMP5-05H | Recombinant Human BMP5 protein, hFc-tagged | +Inquiry |
BMP5-4365H | Recombinant Human BMP5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMP5-3074HCL | Recombinant Human BMP5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BMP5 Products
Required fields are marked with *
My Review for All BMP5 Products
Required fields are marked with *
0
Inquiry Basket