Recombinant Full Length Human BMF Protein, GST-tagged
Cat.No. : | BMF-1721HF |
Product Overview : | Human BMF full-length ORF ( AAH69505.1, 1 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 184 amino acids |
Description : | The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein contains a single BCL2 homology domain 3 (BH3), and has been shown to bind BCL2 proteins and function as an apoptotic activator. This protein is found to be sequestered to myosin V motors by its association with dynein light chain 2, which may be important for sensing intracellular damage and triggering apoptosis. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Form : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 46.9 kDa |
AA Sequence : | MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSPGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BMF Bcl2 modifying factor [ Homo sapiens ] |
Official Symbol | BMF |
Synonyms | BMF; Bcl2 modifying factor; bcl-2-modifying factor; FLJ00065 |
Gene ID | 90427 |
mRNA Refseq | NM_001003940 |
Protein Refseq | NP_001003940 |
MIM | 606266 |
UniProt ID | Q96LC9 |
◆ Recombinant Proteins | ||
Bmf-1879M | Recombinant Mouse Bmf Protein, Myc/DDK-tagged | +Inquiry |
BMF-4721H | Recombinant Human BMF protein, GST-tagged | +Inquiry |
BMF-1721HF | Recombinant Full Length Human BMF Protein, GST-tagged | +Inquiry |
BMF-27487TH | Recombinant Human BMF, T7 -tagged | +Inquiry |
BMF-515H | Recombinant Human BMF protein(Met1-Arg184), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BMF-8438HCL | Recombinant Human BMF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BMF Products
Required fields are marked with *
My Review for All BMF Products
Required fields are marked with *
0
Inquiry Basket