Recombinant Full Length Human BLVRA Protein, GST-tagged

Cat.No. : BLVRA-1712HF
Product Overview : Human BLVRA full-length ORF ( AAH08456, 1 a.a. - 296 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 296 amino acids
Description : Biliverdin reductases, such as BLVRA (EC 1.3.1.24), catalyze the conversion of biliverdin to bilirubin in the presence of NADPH or NADH (Komuro et al., 1996 [PubMed 8950184]).
Form : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 58.3 kDa
AA Sequence : MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BLVRA biliverdin reductase A [ Homo sapiens ]
Official Symbol BLVRA
Synonyms BLVRA; biliverdin reductase A; BLVR; BVR A; biliverdin-IX alpha-reductase; BVR; BVRA
Gene ID 644
mRNA Refseq NM_000712
Protein Refseq NP_000703
MIM 109750
UniProt ID P53004

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All BLVRA Products

Required fields are marked with *

My Review for All BLVRA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon