Recombinant Full Length Human BBS9 Protein, GST-tagged

• Cat.No.: BBS9-1704HF
• Product Overview: Human B1 full-length ORF ( AAH32715, 1 a.a. - 310 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene is downregulated by parathyroid hormone in osteoblastic cells, and therefore, is thought to be involved in parathyroid hormone action in bones. The exact function of this gene has not yet been determined. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 59.84 kDa
• Protein length: 310 amino acids
• AA Sequence: MGYLRIFSPHPAKTGDGAQAEDLLLEVDLRDPVLQVEVGKFVSGTEMLHLAVLHSRKLCVYSVSGTLGNVEHGNQCQMKLMYEHNLQRTACNMTYGSFGGVKGRDLICIQSMDGMLMVFEQESYAFGRFLPGFLLPGPLAYSSRTDSFLTVSSCQQVESYKYQVLAFATDADKRQETEQQKLGSGKRLVVDWTLNIGEQALDICIVSFNQSASSVFVLGERNFFCLKDNGQIRFMKKLDWSPSCFLPYCSVSEGTINTLIGNHNNMLHIYQDVTLKWATQLPHIPVAVRVGCLQFSLWKHLLPRSSTLEK
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: BBS9 Bardet-Biedl syndrome 9 [ Homo sapiens (human) ]
• Official Symbol: BBS9
• Synonyms: B1; D1; C18; PTHB1; BBS9
• Gene ID: 27241
• mRNA Refseq: NM_001033604.1
• Protein Refseq: NP_001028776.1
• MIM: 607968
• UniProt ID: Q3SYG4