Recombinant Full Length Human BAG5 Protein, C-Flag-tagged
Cat.No. : | BAG5-967HFL |
Product Overview : | Recombinant Full Length Human BAG5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the BAG1-related protein family. BAG1 is an anti-apoptotic protein that functions through interactions with a variety of cell apoptosis and growth related proteins including BCL-2, Raf-protein kinase, steroid hormone receptors, growth factor receptors and members of the heat shock protein 70 kDa family. This protein contains a BAG domain near the C-terminus, which could bind and inhibit the chaperone activity of Hsc70/Hsp70. Three transcript variants encoding two different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 51 kDa |
AA Sequence : | MDMGNQHPSISRLQEIQKEVKSVEQQVIGFSGLSDDKNYKKLERILTKQLFEIDSVDTEGKGDIQQARKR AAQETERLLKELEQNANHPHRIEIQNIFEEAQSLVREKIVPFYNGGNCVTDEFEEGIQDIILRLTHVKTG GKISLRKARYHTLTKIWAVQEIIEDCMKKQPSLPLSEDAHPSVAKINFVMCEVNKARGVLIALLMGVNNN ETCRHLSCVLSGLIADLDALDVCGRTEIRNYRREVVEDINKLLKYLDLEEEADTTKAFDLRQNHSILKIE KVLKRMREIKNELLQAQNPSELYLSSKTELQGLIGQLDEVSLEKNPCIREARRRAVIEVQTLITYIDLKE ALEKRKLFACEEHPSHKAVWNVLGNLSEIQGEVLSFDGNRTDKNYIRLEELLTKQLLALDAVDPQGEEKC KAARKQAVRLAQNILSYLDLKSDEWEYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | BAG5 BAG cochaperone 5 [ Homo sapiens (human) ] |
Official Symbol | BAG5 |
Synonyms | BAG-5; CMD2F |
Gene ID | 9529 |
mRNA Refseq | NM_004873.4 |
Protein Refseq | NP_004864.1 |
MIM | 603885 |
UniProt ID | Q9UL15 |
◆ Recombinant Proteins | ||
BAG5-3440Z | Recombinant Zebrafish BAG5 | +Inquiry |
BAG5-967HFL | Recombinant Full Length Human BAG5 Protein, C-Flag-tagged | +Inquiry |
BAG5-591R | Recombinant Rat BAG5 Protein, His (Fc)-Avi-tagged | +Inquiry |
BAG5-953M | Recombinant Mouse BAG5 Protein, His (Fc)-Avi-tagged | +Inquiry |
BAG5-933R | Recombinant Rat BAG5 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BAG5-8525HCL | Recombinant Human BAG5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BAG5 Products
Required fields are marked with *
My Review for All BAG5 Products
Required fields are marked with *
0
Inquiry Basket