Recombinant Full Length Human B9D1 Protein, GST-tagged

• Cat.No.: B9D1-3890HF
• Product Overview: Human EPPB9 full-length ORF ( AAH02944.1, 1 a.a. - 153 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a B9 domain-containing protein, one of several that are involved in ciliogenesis. Alterations in expression of this gene have been found in a family with Meckel syndrome. Meckel syndrome has been associated with at least six different genes. This gene is located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq, Mar 2016]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 43.3 kDa
• Protein length: 153 amino acids
• AA Sequence: MATASPSVFLLMVNGQVESAQFPEYDDLYCKYCFVYGQDWAPTAGLEEGISQITSKSQDVRQALVWNFPIDVTFKSTNPYGWPQIVLSVYGPDVFGNDVVRGYGAVHVPFSPGRHKRTIPMFVPESTSKLQKFTSLCLVASSDLQAAPPTEDK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: B9D1 B9 domain containing 1 [ Homo sapiens (human) ]
• Official Symbol: B9D1
• Synonyms: B9D1; B9 domain containing 1; B9 Domain Containing 1; Endothelial Precursor Protein B9; MKS1-Related Protein 1; B9 Protein Domain 1; MKSR1; B9 Domain-Containing Protein 1; JBTS27; EPPB9; MKS9; B9; B9 domain-containing protein 1; B9 protein domain 1; MKS1-related protein 1; endothelial precursor protein B9
• Gene ID: 27077
• mRNA Refseq: NM_001243473
• Protein Refseq: NP_001230402
• MIM: 614144
• UniProt ID: Q9UPM9