Recombinant Full Length Human B3GAT3 Protein, C-Flag-tagged
Cat.No. : | B3GAT3-1205HFL |
Product Overview : | Recombinant Full Length Human B3GAT3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a member of the glucuronyltransferase gene family, enzymes that exhibit strict acceptor specificity, recognizing nonreducing terminal sugars and their anomeric linkages. This gene product catalyzes the formation of the glycosaminoglycan-protein linkage by way of a glucuronyl transfer reaction in the final step of the biosynthesis of the linkage region of proteoglycans. A pseudogene of this gene has been identified on chromosome 3. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 36.9 kDa |
AA Sequence : | MKLKLKNVFLAYFLVSIAGLLYALVQLGQPCDCLPPLRAAAEQLRQKDLRISQLQAELRRPPPAPAQPPE PEALPTIYVVTPTYARLVQKAELVRLSQTLSLVPRLHWLLVEDAEGPTPLVSGLLAASGLLFTHLVVLTP KAQRLREGEPGWVHPRGVEQRNKALDWLRGRGGAVGGEKDPPPPGTQGVVYFADDDNTYSRELFEEMRWT RGVSVWPVGLVGGLRFEGPQVQDGRVVGFHTAWEPSRPFPVDMAGFAVALPLLLDKPNAQFDSTAPRGHL ESSLLSHLVDPKDLEPRAANCTRVLVWHTRTEKPKMKQEEQLQRQGRGSDPAIEVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Protein Pathways : | Chondroitin sulfate biosynthesis, Heparan sulfate biosynthesis, Metabolic pathways |
Full Length : | Full L. |
Gene Name | B3GAT3 beta-1,3-glucuronyltransferase 3 [ Homo sapiens (human) ] |
Official Symbol | B3GAT3 |
Synonyms | JDSCD; GLCATI; glcUAT-I |
Gene ID | 26229 |
mRNA Refseq | NM_012200.4 |
Protein Refseq | NP_036332.2 |
MIM | 606374 |
UniProt ID | O94766 |
◆ Recombinant Proteins | ||
RFL29578HF | Recombinant Full Length Human Galactosylgalactosylxylosylprotein 3-Beta-Glucuronosyltransferase 3(B3Gat3) Protein, His-Tagged | +Inquiry |
B3GAT3-2373H | Recombinant Human B3GAT3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
B3GAT3-228H | Recombinant Human B3GAT3 protein, His-tagged | +Inquiry |
B3GAT3-017H | Recombinant Human B3GAT3 protein, GST-tagged | +Inquiry |
B3GAT3-290H | Recombinant Human B3GAT3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
B3GAT3-8545HCL | Recombinant Human B3GAT3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All B3GAT3 Products
Required fields are marked with *
My Review for All B3GAT3 Products
Required fields are marked with *
0
Inquiry Basket