Recombinant Full Length Human ATG101 Protein, GST-tagged

• Cat.No.: ATG101-1752HF
• Product Overview: Human C12orf44 full-length ORF ( NP_068753.2, 1 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 218 amino acids
• Description: Enables identical protein binding activity. Involved in autophagosome assembly. Located in phagophore assembly site.
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 51.4 kDa
• AA Sequence: MNCRSEVLEVSVEGRQVEEAMLAVLHTVLLHRSTGKFHYKKEGTYSIGTVGTQDVDCDFIDFTYVRVSSEELDRALRKVVGEFKDALRNSGGDGLGQMSLEFYQKKKSRWPFSDECIPWEVWTVKVHVVALATEQERQICREKVGEKLCEKIINIVEVMNRHEYLPKMPTQSEVDNVFDTGLRDVQPYLYKISFQITDALGTSVTTTMRRLIKDTLAL
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ATG101 autophagy related 101 [ Homo sapiens (human) ]
• Official Symbol: ATG101
• Synonyms: C12orf44
• Gene ID: 60673
• mRNA Refseq: NM_021934.3
• Protein Refseq: NP_068753.2
• MIM: 615089
• UniProt ID: Q9BSB4