Recombinant Full Length Human ARSA Protein, C-Flag-tagged
Cat.No. : | ARSA-1847HFL |
Product Overview : | Recombinant Full Length Human ARSA Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene hydrolyzes cerebroside sulfate to cerebroside and sulfate. Defects in this gene lead to metachromatic leucodystrophy (MLD), a progressive demyelination disease which results in a variety of neurological symptoms and ultimately death. Alternatively spliced transcript variants have been described for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 51.9 kDa |
AA Sequence : | MSMGAPRSLLLALAAGLAVARPPNIVLIFADDLGYGDLGCYGHPSSTTPNLDQLAAGGLRFTDFYVPVSL CTPSRAALLTGRLPVRMGMYPGVLVPSSRGGLPLEEVTVAEVLAARGYLTGMAGKWHLGVGPEGAFLPPH QGFHRFLGIPYSHDQGPCQNLTCFPPATPCDGGCDQGLVPIPLLANLSVEAQPPWLPGLEARYMAFAHDL MADAQRQDRPFFLYYASHHTHYPQFSGQSFAERSGRGPFGDSLMELDAAVGTLMTAIGDLGLLEETLVIF TADNGPETMRMSRGGCSGLLRCGKGTTYEGGVREPALAFWPGHIAPGVTHELASSLDLLPTLAALAGAPL PNVTLDGFDLSPLLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYKAHFFTQGSAHSDTTADPACHASS SLTAHEPPLLYDLSKDPGENYNLLGGVAGATPEVLQALKQLQLLKAQLDAAVTFGPSQVARGEDPALQIC CHPGCTPRPACCHCPDPHA myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Lysosome, Sphingolipid metabolism |
Full Length : | Full L. |
Gene Name | ARSA arylsulfatase A [ Homo sapiens (human) ] |
Official Symbol | ARSA |
Synonyms | ASA; MLD |
Gene ID | 410 |
mRNA Refseq | NM_001085425.3 |
Protein Refseq | NP_001078894.2 |
MIM | 607574 |
UniProt ID | P15289 |
◆ Recombinant Proteins | ||
ARSA-2826H | Recombinant Human ARSA Protein, MYC/DDK-tagged | +Inquiry |
ARSA-1847HFL | Recombinant Full Length Human ARSA Protein, C-Flag-tagged | +Inquiry |
ARSA-2502H | Recombinant Human ARSA Protein, His (Fc)-Avi-tagged | +Inquiry |
ARSA-0590H | Recombinant Human ARSA Protein (Arg19-Ala507), C-His-tagged | +Inquiry |
ARSA-572H | Recombinant Human arylsulfatase A, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARSA-3085MCL | Recombinant Mouse ARSA cell lysate | +Inquiry |
ARSA-3086HCL | Recombinant Human ARSA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARSA Products
Required fields are marked with *
My Review for All ARSA Products
Required fields are marked with *
0
Inquiry Basket