Recombinant Full Length Human APOBEC3G Protein, C-Flag-tagged
Cat.No. : | APOBEC3G-547HFL |
Product Overview : | Recombinant Full Length Human APOBEC3G Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. The protein encoded by this gene catalyzes site-specific deamination of both RNA and single-stranded DNA. The encoded protein has been found to be a specific inhibitor of human immunodeficiency virus-1 (HIV-1) infectivity. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 46.2 kDa |
AA Sequence : | MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPPLDAKIFRGQVYSELKYHPEMRF FHWFSKWRKLHRDQEYEVTWYISWSPCTKCTRDMATFLAEDPKVTLTIFVARLYYFWDPDYQEALRSLCQ KRDGPRATMKIMNYDEFQHCWSKFVYSQRELFEPWNNLPKYYILLHIMLGEILRHSMDPPTFTFNFNNEP WVRGRHETYLCYEVERMHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDLDQDYRVT CFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTF VDHQGCPFQPWDGLDEHSQDLSGRLRAILQNQENTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | APOBEC3G apolipoprotein B mRNA editing enzyme catalytic subunit 3G [ Homo sapiens (human) ] |
Official Symbol | APOBEC3G |
Synonyms | A3G; ARCD; ARP9; ARP-9; CEM15; CEM-15; MDS019; bK150C2.7; dJ494G10.1 |
Gene ID | 60489 |
mRNA Refseq | NM_021822.4 |
Protein Refseq | NP_068594.1 |
MIM | 607113 |
UniProt ID | Q9HC16 |
◆ Recombinant Proteins | ||
APOBEC3G-148H | Active Recombinant Human APOBEC3G Protein, His-tagged | +Inquiry |
APOBEC3G-6744H | Recombinant Human APOBEC3G protein, His-SUMO-tagged | +Inquiry |
APOBEC3G-701H | Recombinant Human APOBEC3G protein, GST-tagged | +Inquiry |
APOBEC3G-1576H | Recombinant Human APOBEC3G protein | +Inquiry |
APOBEC3G-547HFL | Recombinant Full Length Human APOBEC3G Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOBEC3G-8784HCL | Recombinant Human APOBEC3G 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All APOBEC3G Products
Required fields are marked with *
My Review for All APOBEC3G Products
Required fields are marked with *
0
Inquiry Basket