Recombinant Full Length Human ANAPC15 Protein, GST-tagged

• Cat.No.: ANAPC15-1824HF
• Product Overview: Human C11orf51 full-length ORF (AAH05156.1, 1 a.a. - 121 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 121 amino acids
• Description: Involved in regulation of mitotic cell cycle spindle assembly checkpoint. Part of anaphase-promoting complex.
• Form: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 39.71 kDa
• AA Sequence: MSTLFPSLFPRVTETLWFNLDRPCVEETELQQQEQQHQAWLQSIAEKDNNLVPIGKPASEHYDDEEEEDDEDDEDSEEDSEDDEDMQDMDEMNDYNESPDDGEVNEVDMEGNEQDQDQWMI
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ANAPC15 anaphase promoting complex subunit 15 [ Homo sapiens ]
• Official Symbol: ANAPC15
• Synonyms: APC15; HSPC020; C11orf51
• Gene ID: 25906
• mRNA Refseq: NM_014042.2
• Protein Refseq: NP_054761.1
• MIM: 614717
• UniProt ID: P60006