Recombinant Full Length Human AMPD3 Protein, C-Flag-tagged
Cat.No. : | AMPD3-1500HFL |
Product Overview : | Recombinant Full Length Human AMPD3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the AMP deaminase gene family. The encoded protein is a highly regulated enzyme that catalyzes the hydrolytic deamination of adenosine monophosphate to inosine monophosphate, a branch point in the adenylate catabolic pathway. This gene encodes the erythrocyte (E) isoforms, whereas other family members encode isoforms that predominate in muscle (M) and liver (L) cells. Mutations in this gene lead to the clinically asymptomatic, autosomal recessive condition erythrocyte AMP deaminase deficiency. Alternatively spliced transcript variants encoding different isoforms of this gene have been described. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 89.5 kDa |
AA Sequence : | MALSSEPAEMPRQFPKLNISEVDEQVRLLAEKVFAKVLREEDSKDALSLFTVPEDCPIGQKEAKERELQK ELAEQKSVETAKRKKSFKMIRSQSLSLQMPPQQDWKGPPAASPAMSPTTPVVTGATSLPTPAPYAMPEFQ RVTISGDYCAGITLEDYEQAAKSLAKALMIREKYARLAYHRFPRITSQYLGHPRADTAPPEEGLPDFHPP PLPQEDPYCLDDAPPNLDYLVHMQGGILFVYDNKKMLEHQEPHSLPYPDLETYTVDMSHILALITDGPTK TYCHRRLNFLESKFSLHEMLNEMSEFKELKSNPHRDFYNVRKVDTHIHAAACMNQKHLLRFIKHTYQTEP DRTVAEKRGRKITLRQVFDGLHMDPYDLTVDSLDVHAGRQTFHRFDKFNSKYNPVGASELRDLYLKTENY LGGEYFARMVKEVARELEESKYQYSEPRLSIYGRSPEEWPNLAYWFIQHKVYSPNMRWIIQVPRIYDIFR SKKLLPNFGKMLENIFLPLFKATINPQDHRELHLFLKYVTGFDSVDDESKHSDHMFSDKSPNPDVWTSEQ NPPYSYYLYYMYANIMVLNNLRRERGLSTFLFRPHCGEAGSITHLVSAFLTADNISHGLLLKKSPVLQYL YYLAQIPIAMSPLSNNSLFLEYSKNPLREFLHKGLHVSLSTDDPMQFHYTKEALMEEYAIAAQVWKLSTC DLCEIARNSVLQSGLSHQEKQKFLGQNYYKEGPEGNDIRKTNVAQIRMAFRYETLCNELSFLSDAMKSEEITALTN |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Metabolic pathways, Purine metabolism |
Full Length : | Full L. |
Gene Name | AMPD3 adenosine monophosphate deaminase 3 [ Homo sapiens (human) ] |
Official Symbol | AMPD3 |
Synonyms | adenosine monophosphate deaminase (isoform E); adenosine monophosphate deaminase 3; AMP aminohydrolase; AMP deaminase 3; erythrocyte-specific AMP deaminase; erythrocyte type AMP deaminase; myoadenylate deaminase |
Gene ID | 272 |
mRNA Refseq | NM_000480.3 |
Protein Refseq | NP_000471.1 |
MIM | 102772 |
UniProt ID | Q01432 |
◆ Recombinant Proteins | ||
Ampd3-146M | Recombinant Mouse Ampd3 Protein, His-tagged | +Inquiry |
AMPD3-1500HFL | Recombinant Full Length Human AMPD3 Protein, C-Flag-tagged | +Inquiry |
AMPD3-4639H | Recombinant Human AMPD3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
AMPD3-511M | Recombinant Mouse AMPD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
AMPD3-4405C | Recombinant Chicken AMPD3 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AMPD3 Products
Required fields are marked with *
My Review for All AMPD3 Products
Required fields are marked with *
0
Inquiry Basket