Recombinant Full Length Human ALX1 Protein, GST-tagged

• Cat.No.: ALX1-2596HF
• Product Overview: Human CART1 full-length ORF (AAH10923.1, 1 a.a. - 326 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 326 amino acids
• Description: The specific function of this gene has yet to be determined in humans; however, in rodents, it is necessary for survival of the forebrain mesenchyme and may also be involved in development of the cervix. Mutations in the mouse gene lead to neural tube defects such as acrania and meroanencephaly. [provided by RefSeq, Jul 2008]
• Molecular Mass: 63.4 kDa
• AA Sequence: MEFLSEKFALKSPPSKNSDFYMGAGGPLEHVMETLDNESFYSKASAGKCVQAFGPLPRAEHHVRLERTSPCQDSSVNYGITKVEGQPLHTELNRAMDNCNSLRMSPVKGMQEKGELDELGDKCDSNVSSSKKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWFQNRRAKWRKRERYGQIQQAKSHFAATYDISVLPRTDSYPQIQNNLWAGNASGGSVVTSCMLPRDTSSCMTPYSHSPRTDSSYTGFSNHQNQFSHVPLNNFFTDSLLTGATNGHAFETKPEFERRSSSIAVLRMKAKEHTANISWAM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ALX1 ALX homeobox 1 [ Homo sapiens ]
• Official Symbol: ALX1
• Synonyms: ALX1; ALX homeobox 1; CART1, cartilage paired class homeoprotein 1; ALX homeobox protein 1; CART-1; cartilage paired-class homeoprotein 1; FND3; CART1
• Gene ID: 8092
• mRNA Refseq: NM_006982
• Protein Refseq: NP_008913
• MIM: 601527
• UniProt ID: Q15699