Recombinant Full Length Human AKR1C3 Protein, C-Flag-tagged
Cat.No. : | AKR1C3-1971HFL |
Product Overview : | Recombinant Full Length Human AKR1C3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. These enzymes catalyze the conversion of aldehydes and ketones to their corresponding alcohols by utilizing NADH and/or NADPH as cofactors. The enzymes display overlapping but distinct substrate specificity. This enzyme catalyzes the reduction of prostaglandin (PG) D2, PGH2 and phenanthrenequinone (PQ), and the oxidation of 9alpha,11beta-PGF2 to PGD2. It may play an important role in the pathogenesis of allergic diseases such as asthma, and may also have a role in controlling cell growth and/or differentiation. This gene shares high sequence identity with three other gene members and is clustered with those three genes at chromosome 10p15-p14. Three transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 36.7 kDa |
AA Sequence : | MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIA DGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFD IVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKD IVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQN VQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Arachidonic acid metabolism, Metabolism of xenobiotics by cytochrome P450 |
Full Length : | Full L. |
Gene Name | AKR1C3 aldo-keto reductase family 1 member C3 [ Homo sapiens (human) ] |
Official Symbol | AKR1C3 |
Synonyms | DD3; DDX; PGFS; HAKRB; HAKRe; HA1753; HSD17B5; hluPGFS |
Gene ID | 8644 |
mRNA Refseq | NM_003739.6 |
Protein Refseq | NP_003730.4 |
MIM | 603966 |
UniProt ID | P42330 |
◆ Recombinant Proteins | ||
AKR1C3-1971HFL | Recombinant Full Length Human AKR1C3 Protein, C-Flag-tagged | +Inquiry |
AKR1C3-140H | Recombinant Human Aldo-keto reductase family 1, member C3, His-tagged | +Inquiry |
AKR1C3-090H | Recombinant Human AKR1C3 Protein, His-tagged | +Inquiry |
AKR1C3-305H | Recombinant Human AKR1C3 Protein, His (Fc)-Avi-tagged | +Inquiry |
AKR1C3-11H | Recombinant Human AKR1C3 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKR1C3-49HCL | Recombinant Human AKR1C3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AKR1C3 Products
Required fields are marked with *
My Review for All AKR1C3 Products
Required fields are marked with *
0
Inquiry Basket