Recombinant Full Length Human AK9 Protein, GST-tagged

• Cat.No.: AK9-2700HF
• Product Overview: Human AK9 full-length ORF (AAH22031, 1 a.a. - 421 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene catalyzes the interconversion of nucleosides, possessing both nucleoside monophosphate and diphosphate kinase activities. The encoded protein uses these interconversions to maintain nucleoside homeostasis. [provided by RefSeq, Jul 2016]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 72.05 kDa
• Protein length: 421 amino acids
• AA Sequence: MTSQEKTEEYPFADIFDEDETERNFLLSKPVCFVVFGKPGVGKTTLARYITQAWKCIRVEALPILEEQIAAETESGVMLQSMLISGQSIPDELVIKLMLEKLNSPEVCHFGYIITEIPSLSQDAMTTLQQIELIKNLNLKPDVIINIKCPDYDLCQRISGQRQHNNTGYIYSRDQWDPEVIENHRKKKKEAQKDGKGEEEEEEEEQEEEEAFIAEMQMVAEILHHLVQRPEDYLENVENIVKLYKETILQTLEEVMAEHNPQYLIELNGNKPAEELFMIVMDRLKYLNLKRAAILTKLQGAEEEINDTMENDELFRTLASYKLIAPRYRWQRSKWGRTCPVNLKDGNIYSGLPDYSVSFLGKIYCLSSEEALKPFLLNPRPYLLPPMPGPPCKVFILGPQYSGKTTLCNMLAENYKGKVTN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AK9 adenylate kinase 9 [ Homo sapiens (human) ]
• Official Symbol: AK9
• Synonyms: AK9; adenylate kinase 9; C6ORF199; chromosome 6 open reading frame 199; MGC26954; dJ70A9.1; adenylate kinase 9; adenylate kinase domain containing 1; adenylate kinase domain containing 2; EC 2.7.4.4; EC 2.7.4.6
• Gene ID: 221264
• mRNA Refseq: NM_001145128
• Protein Refseq: NP_001138600
• MIM: 615358
• UniProt ID: Q5TCS8