Recombinant Full Length Human AIF1L Protein, GST-tagged

• Cat.No.: AIF1L-2582HF
• Product Overview: Human C9orf58 full-length ORF (NP_113614.1, 1 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: AIF1L (Allograft Inflammatory Factor 1 Like) is a Protein Coding gene. GO annotations related to this gene include calcium ion binding and actin filament binding. An important paralog of this gene is AIF1.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 43.5 kDa
• Protein length: 150 amino acids
• AA Sequence: MSGELSNRFQGGKAFGLLKARQERRLAEINREFLCDQKYSDEENLPEKLTAFKEKYMEFDLNNEGEIDLMSLKRMMEKLGVPKTHLEMKKMISEVTGGVSDTISYRDFVNMMLGKRSAVLKLVMMFEGKANESSPKPVGPPPERDIASLP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: AIF1L allograft inflammatory factor 1-like [ Homo sapiens ]
• Official Symbol: AIF1L
• Synonyms: AIF1L; allograft inflammatory factor 1-like; C9orf58, chromosome 9 open reading frame 58; FLJ12783; IBA2; ionized calcium binding adapter molecule 2; ionized calcium-binding adapter molecule 2; C9orf58; MGC29466
• Gene ID: 83543
• mRNA Refseq: NM_001185095
• Protein Refseq: NP_001172024
• UniProt ID: Q9BQI0