Recombinant Full Length Human AHCYL2 Protein, C-Flag-tagged
Cat.No. : | AHCYL2-1944HFL |
Product Overview : | Recombinant Full Length Human AHCYL2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene acts as a homotetramer and may be involved in the conversion of S-adenosyl-L-homocysteine to L-homocysteine and adenosine. Several transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 66.4 kDa |
AA Sequence : | MSVQVVSAAAAAKVPEVELKDLSPSEAESQLGLSTAAVGAMAPPAGGGDPEAPAPAAERPPVPGPGSGPA AALSPAAGKVPQASAMKRSDPHHQHQRHRDGGEALVSPDGTVTEAPRTVKKIQFADQKQEFNKRPTKIGR RSLSRSISQSSTDSYSSAASYTDSSDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIEIAEQEMPAL MALRKRAQGEKPLAGAKIVGCTHITAQTAVLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAW KGESEDDFWWCIDRCVNVEGWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAGK LCVPAMNVNDSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYVT EIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGHSNTEIDVASLR TPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLNLSCSTVPTFVLSITATTQALALIELYNAPEGRYKQD VYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNKNGPFKPNYYRY myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Cysteine and methionine metabolism, Metabolic pathways, Selenoamino acid metabolism |
Full Length : | Full L. |
Gene Name | AHCYL2 adenosylhomocysteinase like 2 [ Homo sapiens (human) ] |
Official Symbol | AHCYL2 |
Synonyms | IRBIT2; ADOHCYASE3 |
Gene ID | 23382 |
mRNA Refseq | NM_001130720.3 |
Protein Refseq | NP_001124192.1 |
MIM | 616520 |
UniProt ID | Q96HN2 |
◆ Recombinant Proteins | ||
AHCYL2-311H | Recombinant Human AHCYL2 Protein, MYC/DDK-tagged | +Inquiry |
ACAA1-3733H | Recombinant Human ACAA1 protein, GST-tagged | +Inquiry |
AHCYL2-5709H | Recombinant Human AHCYL2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
AHCYL2-296H | Recombinant Human AHCYL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
AHCYL2-1944HFL | Recombinant Full Length Human AHCYL2 Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AHCYL2 Products
Required fields are marked with *
My Review for All AHCYL2 Products
Required fields are marked with *
0
Inquiry Basket