Recombinant Full Length Human AGR2 Protein, C-Flag-tagged
Cat.No. : | AGR2-936HFL |
Product Overview : | Recombinant Full Length Human AGR2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, and a C-terminal ER-retention sequence. This protein plays a role in cell migration, cellular transformation and metastasis and is as a p53 inhibitor. As an ER-localized molecular chaperone, it plays a role in the folding, trafficking, and assembly of cysteine-rich transmembrane receptors and the cysteine-rich intestinal gylcoprotein mucin. This gene has been implicated in inflammatory bowel disease and cancer progression. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 19.8 kDa |
AA Sequence : | MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEEALYKSKTSNK PLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRAD ITGRYSNRLYAYEPADTALLLDNMKKALKLLKTELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Full Length : | Full L. |
Gene Name | AGR2 anterior gradient 2, protein disulphide isomerase family member [ Homo sapiens (human) ] |
Official Symbol | AGR2 |
Synonyms | AG2; AG-2; HPC8; GOB-4; HAG-2; XAG-2; PDIA17; HEL-S-116 |
Gene ID | 10551 |
mRNA Refseq | NM_006408.4 |
Protein Refseq | NP_006399.1 |
MIM | 606358 |
UniProt ID | O95994 |
◆ Recombinant Proteins | ||
AGR2-230H | Recombinant Human AGR2 Protein, His-tagged | +Inquiry |
AGR2-441H | Recombinant Human AGR2 Protein, GST-tagged | +Inquiry |
AGR2-101R | Recombinant Rhesus Macaque AGR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
AGR2-26141TH | Recombinant Human AGR2, His-tagged | +Inquiry |
Agr2-1099M | Recombinant Mouse Agr2 protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGR2-8972HCL | Recombinant Human AGR2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AGR2 Products
Required fields are marked with *
My Review for All AGR2 Products
Required fields are marked with *
0
Inquiry Basket