Recombinant Full Length Human ADH7 Protein, C-Myc/DDK-tagged

Cat.No. : ADH7-22HFL
Product Overview : Recombinant Full Length Human ADH7 Protein, fused to Myc/DDK-tag at C-terminus, was expressed in HEK293T.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes class IV alcohol dehydrogenase 7 mu or sigma subunit, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. The enzyme encoded by this gene is inefficient in ethanol oxidation, but is the most active as a retinol dehydrogenase; thus it may participate in the synthesis of retinoic acid, a hormone important for cellular differentiation. The expression of this gene is much more abundant in stomach than liver, thus differing from the other known gene family members. Alternative splicing results in multiple transcript variants.
Source : HEK293T
Species : Human
Tag : Myc&DDK
Form : 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol.
Molecular Mass : 41.3 kDa
AA Sequence : MFAEIQIQDKDRMGTAGKVIKCKAAVLWEQKQPFSIEEIEVAPPKTKEVRIKILATGICRTDDHVIKGTM VSKFPVIVGHEATGIVESIGEGVTTVKPGDKVIPLFLPQCRECNACRNPDGNLCIRSDITGRGVLADGTT RFTCKGKPVHHFMNTSTFTEYTVVDESSVAKIDDAAPPEKVCLIGCGFSTGYGAAVKTGKVKPGSTCVVF GLGGVGLSVIMGCKSAGASRIIGIDLNKDKFEKAMAVGATECISPKDSTKPISEVLSEMTGNNVGYTFEV IGHLETMIDALASCHMNYGTSVVVGVPPSAKMLTYDPMLLFTGRTWKGCVFGGLKSRDDVPKLVTEFLAK KFDLDQLITHVLPFKKISEGFELLNSGQSIRTVLTF myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Notes : For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome
Protein Pathways : Drug metabolism - cytochrome P450, Fatty acid metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Metabolism of xenobiotics by cytochrome P450, Retinol metabolism, Tyrosine metabolism
Full Length : Full L.
Gene Name ADH7 alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide [ Homo sapiens (human) ]
Official Symbol ADH7
Synonyms ADH4
Gene ID 131
mRNA Refseq NM_000673.7
Protein Refseq NP_000664.3
MIM 600086
UniProt ID P40394

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ADH4 Products

Required fields are marked with *

My Review for All ADH4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon