Recombinant Full Length Human Adenosine Receptor A3(Adora3) Protein, His-Tagged
Cat.No. : | RFL-11531HF |
Product Overview : | Recombinant Full Length Human Adenosine receptor A3(ADORA3) Protein (P33765) (1-318aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-318) |
Form : | Lyophilized powder |
AA Sequence : | MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC VVCHPSDSLDTSIEKNSE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Adenosine receptor A3(ADORA3) |
UniProt ID | P33765 |
◆ Recombinant Proteins | ||
DKK2-2665H | Recombinant Human DKK2 Protein, His-tagged | +Inquiry |
CEP135-1223H | Recombinant Human CEP135 protein, GST-tagged | +Inquiry |
TCEANC2-198H | Recombinant Human TCEANC2 Protein, His-tagged | +Inquiry |
RFL35967GF | Recombinant Full Length Geobacillus Sp. Upf0756 Membrane Protein Gwch70_2680 (Gwch70_2680) Protein, His-Tagged | +Inquiry |
NS1-19D | Recombinant Dengue type 3 NS1 Protein | +Inquiry |
◆ Native Proteins | ||
OVAL-140C | Native Chicken ovalbumin | +Inquiry |
TIMP1-30840TH | Native Human TIMP1 | +Inquiry |
C4BPB-184H | Native Human C4b-Binding Protein | +Inquiry |
Tnnt3-7424M | Native Mouse Tnnt3 Protein | +Inquiry |
TOD-43 | Active Native Tyramine Oxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
Small Intestine-449C | Cynomolgus monkey Small intestine Lysate | +Inquiry |
SOCS2-1581HCL | Recombinant Human SOCS2 293 Cell Lysate | +Inquiry |
GPT-721RCL | Recombinant Rat GPT cell lysate | +Inquiry |
ISOC1-5144HCL | Recombinant Human ISOC1 293 Cell Lysate | +Inquiry |
AK4-001HCL | Recombinant Human AK4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Adenosine receptor A3(ADORA3) Products
Required fields are marked with *
My Review for All Adenosine receptor A3(ADORA3) Products
Required fields are marked with *
0
Inquiry Basket