Recombinant Full Length Human ACAT2 Protein, C-Flag-tagged

• Cat.No.: ACAT2-1055HFL
• Product Overview: Recombinant Full Length Human ACAT2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: The product of this gene is an enzyme involved in lipid metabolism, and it encodes cytosolic acetoacetyl-CoA thiolase. This gene shows complementary overlapping with the 3-prime region of the TCP1 gene in both mouse and human. These genes are encoded on opposite strands of DNA, as well as in opposite transcriptional orientation. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 41.2 kDa
• AA Sequence: MNAGSDPVVIVSAARTIIGSFNGALAAVPVQDLGSTVIKEVLKRATVAPEDVSEVIFGHVLAAGCGQNPV RQASVGAGIPYSVPAWSCQMICGSGLKAVCLAVQSIGIGDSSIVVAGGMENMSKAPHLAYLRTGVKIGEM PLTDSILCDGLTDAFHNCHMGITAENVAKKWQVSREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTR RGLIEVKTDEFPRHGSNIEAMSKLKPYFLTDGTGTVTPANASGINDGAAAVVLMKKSEADKRGLTPLARI VSWSQVGVEPSIMGIGPIPAIKQAVTKAGWSLEDVDIFEINEAFAAVSAAIVKELGLNPEKVNIEGGAIA
  LGHPLGASGCRILVTLLHTLERMGRSRGVAALCIGGGMGIAMCVQRETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome
• Protein Pathways: Butanoate metabolism, Fatty acid metabolism, Lysine degradation, Metabolic pathways, Propanoate metabolism, Pyruvate metabolism, Synthesis and degradation of ketone bodies, Terpenoid backbone biosynthesis, Tryptophan metabolism, Valine, leucine and isoleucine degradation
• Full Length: Full L.

Gene Information

• Gene Name: ACAT2 acetyl-CoA acetyltransferase 2 [ Homo sapiens (human) ]
• Official Symbol: ACAT2
• Synonyms: acetoacetyl Coenzyme A thiolase; acetyl-Coenzyme A acetyltransferase 2; cytosolic acetoacetyl-CoA thiolase; OTTHUMP00000017527
• Gene ID: 39
• mRNA Refseq: NM_005891.3
• Protein Refseq: NP_005882.2
• MIM: 100678
• UniProt ID: Q9BWD1