Recombinant Human ACAT2 protein, T7-tagged

Source :	E. coli
Species :	Human
Tag :	T7
Form :	1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
AA Sequence :	MASMTGGQQMGRGEFGSNAGSDPVVIVSAARTIIGSFNGALAAVPVQDLGSTVIKEVLKRATVAPEDVSEVIFGH VLAAGCGQNPVRQASVGAGIPYSVPAWSCQMICGSGLKAVCLAVQSIGIGDSSIVVAGGMENMSKAPHLAYLRTG VKIGEMPLTDSILCDGLTDAFHNCHMGITAENVAKKWQVSREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVST RKGLIEVKTDEFPRHGSNIEAMSKLKPYFLTDGTGTVTPANASGINDGAAAVVLMKKSEADKRGLTPLARIVSWS QVGVEPSIMGIGPIPAIKQAVTKAGWSLEDVDIFEINEAFAAVSAAIVKELGLNPEKVNIEGGAIALGHPLGASG CRILVTLLHTLERMGRSRGVAALCIGGGMGIAMCVQRE
Purity :	>90% by SDS-PAGE
Applications :	1. May be used for cell lipid metabolic pathway regulation study in vitro using recombinant ACAT2 protein intracellular delivery methods.2. May be used for in vitro protein–protein interaction measurement for mapping ACAT2 binder.3. Excellent lysine acetylation subtract protein for enzymatic assay development.4. May be used as antigen for specific antibody development.
Storage :	Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.

Gene Name	ACAT2 acetyl-CoA acetyltransferase 2 [ Homo sapiens ]
Official Symbol	ACAT2
Synonyms	ACAT2; acetyl-CoA acetyltransferase 2; acetyl Coenzyme A acetyltransferase 2 , acetyl Coenzyme A acetyltransferase 2 (acetoacetyl Coenzyme A thiolase); acetyl-CoA acetyltransferase, cytosolic; acetoacetyl Coenzyme A thiolase; cytosolic acetoacetyl-CoA thiolase; acetyl-CoA transferase-like protein;
Gene ID	39
mRNA Refseq	NM_005891
Protein Refseq	NP_005882
MIM	100678
UniProt ID	Q9BWD1
Chromosome Location	6q25.3-q26
Pathway	Butanoate metabolism, organism-specific biosystem; Butanoate metabolism, conserved biosystem; C5 isoprenoid biosynthesis, mevalonate pathway, organism-specific biosystem; C5 isoprenoid biosynthesis, mevalonate pathway, conserved biosystem; Fat digestion and absorption, organism-specific biosystem; Fat digestion and absorption, conserved biosystem; Fatty acid metabolism, organism-specific biosystem;
Function	acetyl-CoA C-acetyltransferase activity; transferase activity, transferring acyl groups other than amino-acyl groups;