Recombinant Full Length Human ACAA2 Protein, C-Flag-tagged

• Cat.No.: ACAA2-1365HFL
• Product Overview: Recombinant Full Length Human ACAA2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Description: The encoded protein catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal.
• Source: Mammalian cells
• Species: Human
• Tag: Flag
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 41.7 kDa
• AA Sequence: MALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETVDSVIMGNVLQSSSDAIYLA RHVGLRVGIPKETPALTINRLCGSGFQSIVNGCQEICVKEAEVVLCGGTESMSQAPYCVRNVRFGTKLGS DIKLEDSLWVSLTDQHVQLPMAMTAENLAVKHKISREECDKYALQSQQRWKAANDAGYFNDEMAPIEVKT KKGKQTMQVDEHARPQTTLEQLQKLPPVFKKDGTVTAGNASGVADGAGAVIIASEDAVKKHNFTPLARIV GYFVSGCDPSIMGIGPVPAISGALKKAGLSLKDMDLVEVNEAFAPQYLAVERSLDLDISKTNVNGGAIAL
  GHPLGGSGSRITAHLVHELRRRGGKYAVGSACIGGGQGIAVIIQSTATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Pathways: Fatty acid elongation in mitochondria, Fatty acid metabolism, Metabolic pathways, Valine, leucine and isoleucine degradation
• Full Length: Full L.

Gene Information

• Gene Name: ACAA2 acetyl-CoA acyltransferase 2 [ Homo sapiens (human) ]
• Official Symbol: ACAA2
• Synonyms: DSAEC
• Gene ID: 10449
• mRNA Refseq: NM_006111.3
• Protein Refseq: NP_006102.2
• MIM: 604770
• UniProt ID: P42765