Recombinant Full Length Human ABHD5 Protein, C-Flag-tagged
Cat.No. : | ABHD5-580HFL |
Product Overview : | Recombinant Full Length Human ABHD5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene belongs to a large family of proteins defined by an alpha/beta hydrolase fold, and contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. It differs from other members of this subfamily in that its putative catalytic triad contains an asparagine instead of the serine residue. Mutations in this gene have been associated with Chanarin-Dorfman syndrome, a triglyceride storage disease with impaired long-chain fatty acid oxidation. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 38.9 kDa |
AA Sequence : | MAAEEEEVDSADTGERSGWLTGWLPTWCPTSISHLKEAEEKMLKCVPCTYKKEPVRISNGNKIWTLKFSH NISNKTPLVLLHGFGGGLGLWALNFGDLCTNRPVYAFDLLGFGRSSRPRFDSDAEEVENQFVESIEEWRC ALGLDKMILLGHNLGGFLAAAYSLKYPSRVNHLILVEPWGFPERPDLADQDRPIPVWIRALGAALTPFNP LAGLRIAGPFGLSLVQRLRPDFKRKYSSMFEDDTVTEYIYHCNVQTPSGETAFKNMTIPYGWAKRPMLQR IGKMHPDIPVSVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQKVKEICDTVDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Protease |
Full Length : | Full L. |
Gene Name | ABHD5 abhydrolase domain containing 5, lysophosphatidic acid acyltransferase [ Homo sapiens (human) ] |
Official Symbol | ABHD5 |
Synonyms | CGI58; IECN2; NCIE2 |
Gene ID | 51099 |
mRNA Refseq | NM_016006.6 |
Protein Refseq | NP_057090.2 |
MIM | 604780 |
UniProt ID | Q8WTS1 |
◆ Recombinant Proteins | ||
ABHD5-879HF | Recombinant Full Length Human ABHD5 Protein, GST-tagged | +Inquiry |
ABHD5-580HFL | Recombinant Full Length Human ABHD5 Protein, C-Flag-tagged | +Inquiry |
ABHD5-192R | Recombinant Rhesus monkey ABHD5 Protein, His-tagged | +Inquiry |
ABHD5-1134M | Recombinant Mouse ABHD5 Protein | +Inquiry |
ABHD5-4635H | Recombinant Human ABHD5 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABHD5-9132HCL | Recombinant Human ABHD5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABHD5 Products
Required fields are marked with *
My Review for All ABHD5 Products
Required fields are marked with *
0
Inquiry Basket