Recombinant Full Length Human ABHD12 Protein, C-Flag-tagged
Cat.No. : | ABHD12-1002HFL |
Product Overview : | Recombinant Full Length Human ABHD12 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes an enzyme that catalyzes the hydrolysis of 2-arachidonoyl glycerol (2-AG), the main endocannabinoid lipid transmitter that acts on cannabinoid receptors, CB1 and CB2. The endocannabinoid system is involved in a wide range of physiological processes, including neurotransmission, mood, appetite, pain appreciation, addiction behavior, and inflammation. Mutations in this gene are associated with the neurodegenerative disease, PHARC (polyneuropathy, hearing loss, ataxia, retinitis pigmentosa, and cataract), resulting from an inborn error of endocannabinoid metabolism. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 44.9 kDa |
AA Sequence : | MRKRTEPVALEHERCAAAGSSSSGSAAAALDADCRLKQNLRLTGPAAAEPRCAADAGMKRALGRRKGVWL RLRKILFCVLGLYIAIPFLIKLCPGIQAKLIFLNFVRVPYFIDLKKPQDQGLNHTCNYYLQPEEDVTIGV WHTVPAVWWKNAQGKDQMWYEDALASSHPIILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGD SVGTPSERGMTYDALHVFDWIKARSGDNPVYIWGHSLGTGVATNLVRRLCERETPPDALILESPFTNIRE EAKSHPFSVIYRYFPGFDWFFLDPITSSGIKFANDENVKHISCPLLILHAEDDPVVPFQLGRKLYSIAAP ARSFRDFKVQFVPFHSDLGYRHKYIYKSPELPRILREFLGKSEPEHQHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Protease, Transmembrane |
Full Length : | Full L. |
Gene Name | ABHD12 abhydrolase domain containing 12, lysophospholipase [ Homo sapiens (human) ] |
Official Symbol | ABHD12 |
Synonyms | PHARC; ABHD12A; BEM46L2; hABHD12; C20orf22; dJ965G21.2 |
Gene ID | 26090 |
mRNA Refseq | NM_001042472.3 |
Protein Refseq | NP_001035937.1 |
MIM | 613599 |
UniProt ID | Q8N2K0 |
◆ Recombinant Proteins | ||
ABHD12-15R | Recombinant Rhesus Macaque ABHD12 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABHD12-1123M | Recombinant Mouse ABHD12 Protein | +Inquiry |
RFL-17285XF | Recombinant Full Length Xenopus Tropicalis Monoacylglycerol Lipase Abhd12(Abhd12) Protein, His-Tagged | +Inquiry |
ABHD12-247H | Recombinant Human ABHD12 Protein, His (Fc)-Avi-tagged | +Inquiry |
ABHD12-186R | Recombinant Rhesus monkey ABHD12 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABHD12-9HCL | Recombinant Human ABHD12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABHD12 Products
Required fields are marked with *
My Review for All ABHD12 Products
Required fields are marked with *
0
Inquiry Basket