Recombinant Full Length Human 7-Dehydrocholesterol Reductase(Dhcr7) Protein, His-Tagged
Cat.No. : | RFL2095HF |
Product Overview : | Recombinant Full Length Human 7-dehydrocholesterol reductase(DHCR7) Protein (Q9UBM7) (1-475aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-475) |
Form : | Lyophilized powder |
AA Sequence : | MAAKSQPNIPKAKSLDGVTNDRTASQGQWGRAWEVDWFSLASVIFLLLFAPFIVYYFIMA CDQYSCALTGPVVDIVTGHARLSDIWAKTPPITRKAAQLYTLWVTFQVLLYTSLPDFCHK FLPGYVGGIQEGAVTPAGVVNKYQINGLQAWLLTHLLWFANAHLLSWFSPTIIFDNWIPL LWCANILGYAVSTFAMVKGYFFPTSARDCKFTGNFFYNYMMGIEFNPRIGKWFDFKLFFN GRPGIVAWTLINLSFAAKQRELHSHVTNAMVLVNVLQAIYVIDFFWNETWYLKTIDICHD HFGWYLGWGDCVWLPYLYTLQGLYLVYHPVQLSTPHAVGVLLLGLVGYYIFRVANHQKDL FRRTDGRCLIWGRKPKVIECSYTSADGQRHHSKLLVSGFWGVARHFNYVGDLMGSLAYCL ACGGGHLLPYFYIIYMAILLTHRCLRDEHRCASKYGRDWERYTAAVPYRLLPGIF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | DHCR7 |
Synonyms | DHCR7; D7SR; 7-dehydrocholesterol reductase; 7-DHC reductase; Delta7-sterol reductase; Sterol Delta(7-reductase; Sterol reductase SR-2 |
UniProt ID | Q9UBM7 |
◆ Recombinant Proteins | ||
DHCR7-293B | Recombinant Bovine DHCR7 Full Length Transmembrane protein, His-tagged | +Inquiry |
DHCR7-4340C | Recombinant Chicken DHCR7 | +Inquiry |
RFL34220BF | Recombinant Full Length Bovine 7-Dehydrocholesterol Reductase(Dhcr7) Protein, His-Tagged | +Inquiry |
RFL32768DF | Recombinant Full Length Danio Rerio 7-Dehydrocholesterol Reductase(Dhcr7) Protein, His-Tagged | +Inquiry |
DHCR7-4553M | Recombinant Mouse DHCR7 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
DHCR7-6949HCL | Recombinant Human DHCR7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DHCR7 Products
Required fields are marked with *
My Review for All DHCR7 Products
Required fields are marked with *
0
Inquiry Basket