Recombinant Full Length Human 3-Hydroxyacyl-Coa Dehydratase 3(Ptplad1) Protein, His-Tagged
Cat.No. : | RFL25724HF |
Product Overview : | Recombinant Full Length Human 3-hydroxyacyl-CoA dehydratase 3(PTPLAD1) Protein (Q9P035) (1-362aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-362) |
Form : | Lyophilized powder |
AA Sequence : | MENQVLTPHVYWAQRHRELYLRVELSDVQNPAISITENVLHFKAQGHGAKGDNVYEFHLE FLDLVKPEPVYKLTQRQVNITVQKKVSQWWERLTKQEKRPLFLAPDFDRWLDESDAEMEL RAKEEERLNKLRLESEGSPETLTNLRKGYLFMYNLVQFLGFSWIFVNLTVRFCILGKESF YDTFHTVADMMYFCQMLAVVETINAAIGVTTSPVLPSLIQLLGRNFILFIIFGTMEEMQN KAVVFFVFYLWSAIEIFRYSFYMLTCIDMDWKVLTWLRYTLWIPLYPLGCLAEAVSVIQS IPIFNETGRFSFTLPYPVKIKVRFSFFLQIYLIMIFLGLYINFRHLYKQRRRRYGQKKKK IH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HACD3 |
Synonyms | HACD3; BIND1; PTPLAD1; Very-long-chain; 3R-3-hydroxyacyl-CoA dehydratase 3; 3-hydroxyacyl-CoA dehydratase 3; HACD3; Butyrate-induced protein 1; B-ind1; hB-ind1; Protein-tyrosine phosphatase-like A domain-containing protein 1 |
UniProt ID | Q9P035 |
◆ Recombinant Proteins | ||
BRD2-4345H | Recombinant Human BRD2 protein, His&FLAG-tagged | +Inquiry |
NEK7-2999R | Recombinant Rhesus monkey NEK7 Protein, His-tagged | +Inquiry |
SNAPC1-8519M | Recombinant Mouse SNAPC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD63-203H | Recombinant Human CD63 Protein, C-His-tagged | +Inquiry |
CYP2A13-2345HF | Recombinant Full Length Human CYP2A13 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Avidin-014 | Native Avidin Protein, Gold conjugated | +Inquiry |
NEFH-01P | Native Pig NEFH Protein | +Inquiry |
CP-8073H | Native Human Plasma Ceruloplasmin | +Inquiry |
Lectin-1738S | Active Native Sambucus Nigra Lectin Protein, Fluorescein labeled | +Inquiry |
IgG-7437M | Native Mouse IgG Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TADA2A-1281HCL | Recombinant Human TADA2A 293 Cell Lysate | +Inquiry |
CAPN14-02HCL | Recombinant Human CAPN14 HEK293T cell lysate | +Inquiry |
ANP32E-8840HCL | Recombinant Human ANP32E 293 Cell Lysate | +Inquiry |
NOS1-3761HCL | Recombinant Human NOS1 293 Cell Lysate | +Inquiry |
ZNF383-2020HCL | Recombinant Human ZNF383 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HACD3 Products
Required fields are marked with *
My Review for All HACD3 Products
Required fields are marked with *
0
Inquiry Basket