Recombinant Full Length Human 2-Oxoglutarate Receptor 1(Oxgr1) Protein, His-Tagged

• Cat.No.: RFL33645HF
• Product Overview: Recombinant Full Length Human 2-oxoglutarate receptor 1(OXGR1) Protein (Q96P68) (1-337aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• ProteinLength: Full Length (1-337)
• Form: Lyophilized powder
• AA Sequence: MNEPLDYLANASDFPDYAAAFGNCTDENIPLKMHYLPVIYGIIFLVGFPGNAVVISTYIF KMRPWKSSTIIMLNLACTDLLYLTSLPFLIHYYASGENWIFGDFMCKFIRFSFHFNLYSS ILFLTCFSIFRYCVIIHPMSCFSIHKTRCAVVACAVVWIISLVAVIPMTFLITSTNRTNR SACLDLTSSDELNTIKWYNLILTATTFCLPLVIVTLCYTTIIHTLTHGLQTDSCLKQKAR RLTILLLLAFYVCFLPFHILRVIRIESRLLSISCSIENQIHEAYIVSRPLAALNTFGNLL LYVVVSDNFQQAVCSTVRCKVSGNLEQAKKISYSNNP
• Purity: Greater than 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: OXGR1
• Synonyms: OXGR1; GPR80; GPR99; P2RY15; P2Y15; 2-oxoglutarate receptor 1; Alpha-ketoglutarate receptor 1; G-protein coupled receptor 80; G-protein coupled receptor 99; P2Y purinoceptor 15; P2Y-like GPCR; P2Y-like nucleotide receptor
• UniProt ID: Q96P68