Recombinant Full Length Heterodontus Francisci Ig Heavy Chain C Region, Membrane-Bound Form Protein, His-Tagged
Cat.No. : | RFL5725HF |
Product Overview : | Recombinant Full Length Heterodontus francisci Ig heavy chain C region, membrane-bound form Protein (P23088) (1-461aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Heterodontus francisci (Horn shark) (Cestracion francisci) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-461) |
Form : | Lyophilized powder |
AA Sequence : | ATPSPPTLYGLCSCEQPNTDGSLAYGCLAMDYIPQITSVSWKKDNEPITTGLKTYPSVLN KKGTYTQSSQLTITESEVGSSKIYCEVRRGESVWIKEIPDCKGDKVHPTVILTQSSSEEI TSRRFATVLCSIIDFHPESITVSWLKDGQHMESGFVTSPTCGVNGTFSATSRLTVPAREW FTNKVYTCQVSHQGVTQSRNITGSQVPCSCNDPVIKLLPPSIEQVLLEATVTLTCVVSNA PYGVNVSWTQEQKSLKSEIAVQPGEDADSVISTVNISTQAWLSGAEFYCVVNHQDLPTPL RASIHKEEVKDLREPSVSILLSPAEDVSAQRFLSLTCLVRGFFPREIFVKWTVNDKSVNP GNYKNTEVMAENDNSSYFIYSLLSIAAEEWASGASYSCVVGHEAIPLKIINRTVNKSSDS SDHIWIEDNEEESAIDNASTFIILFFLSIFYRAAVTLVKVK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Heterodontus francisci Ig heavy chain C region, membrane-bound form |
Synonyms | Ig heavy chain C region, membrane-bound form; Clone 3050 |
UniProt ID | P23088 |
◆ Recombinant Proteins | ||
CHIT1-600H | Recombinant Human CHIT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SCRG1-5650C | Recombinant Chicken SCRG1 | +Inquiry |
DCAF13-10480Z | Recombinant Zebrafish DCAF13 | +Inquiry |
FBXL20-12778H | Recombinant Human FBXL20, His-tagged | +Inquiry |
ENO1-30HFL | Recombinant Full Length Human ENO1 Protein, C-Flag-tagged | +Inquiry |
◆ Native Proteins | ||
PPBP-30279TH | Native Human PPBP | +Inquiry |
AFP-412H | Native Human AFP Protein | +Inquiry |
NEFM-1520B | Native Bovine NEFM | +Inquiry |
Lectin-1757C | Active Native Canavalia ensiformis Concanavalin A Protein, Biotinylated | +Inquiry |
SNCA-27339TH | Native Human SNCA | +Inquiry |
◆ Cell & Tissue Lysates | ||
FBXO44-6292HCL | Recombinant Human FBXO44 293 Cell Lysate | +Inquiry |
PPTC7-495HCL | Recombinant Human PPTC7 lysate | +Inquiry |
Colon Ascending-7H | Human Adult Colon Ascending Membrane Lysate | +Inquiry |
HBB-5622HCL | Recombinant Human HBB 293 Cell Lysate | +Inquiry |
GSK3B-717HCL | Recombinant Human GSK3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Heterodontus francisci Ig heavy chain C region, membrane-bound form Products
Required fields are marked with *
My Review for All Heterodontus francisci Ig heavy chain C region, membrane-bound form Products
Required fields are marked with *
0
Inquiry Basket