Recombinant Full Length Hemigrapsus Sanguineus Compound Eye Opsin Bcrh1 Protein, His-Tagged
Cat.No. : | RFL31179HF |
Product Overview : | Recombinant Full Length Hemigrapsus sanguineus Compound eye opsin BCRH1 Protein (Q25157) (1-377aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Hemigrapsus sanguineus (Asian shore crab) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-377) |
Form : | Lyophilized powder |
AA Sequence : | MANVTGPQMAFYGSGAATFGYPEGMTVADFVPDRVKHMVLDHWYNYPPVNPMWHYLLGVV YLFLGVISIAGNGLVIYLYMKSQALKTPANMLIVNLALSDLIMLTTNFPPFCYNCFSGGR WMFSGTYCEIYAALGAITGVCSIWTLCMISFDRYNIICNGFNGPKLTQGKATFMCGLAWV ISVGWSLPPFFGWGSYTLEGILDSCSYDYFTRDMNTITYNICIFIFDFFLPASVIVFSYV FIVKAIFAHEAAMRAQAKKMNVTNLRSNEAETQRAEIRIAKTALVNVSLWFICWTPYAAI TIQGLLGNAEGITPLLTTLPALLAKSCSCYNPFVYAISHPKFRLAITQHLPWFCVHEKDP NDVEENQSSNTQTQEKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Hemigrapsus sanguineus Compound eye opsin BCRH1 |
Synonyms | Compound eye opsin BCRH1 |
UniProt ID | Q25157 |
◆ Recombinant Proteins | ||
CBX1-3580H | Recombinant Human CBX1, His-tagged | +Inquiry |
C3AR1-1146M | Recombinant Mouse C3AR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL25281SF | Recombinant Full Length Sphingomonas Wittichii Upf0060 Membrane Protein Swit_0423 (Swit_0423) Protein, His-Tagged | +Inquiry |
SLAMF7-186HA | Recombinant Human SLAMF7 protein, Fc-tagged, APC labeled | +Inquiry |
PTHLH-4480R | Recombinant Rat PTHLH Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Protease-20S | Active Native Streptomyces griseus Protease | +Inquiry |
VTN-384B | Native Bovine Vitronectin | +Inquiry |
FGB-43D | Native Canine Fibrinogen, FITC Labeled | +Inquiry |
SAP-96H | Native Human Serum amyloid P | +Inquiry |
IgG-253R | Native Rabbit IgG Protein, Tag Free, Agarose Conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
EBI3-240HCL | Recombinant Human EBI3 lysate | +Inquiry |
PRKD1-2851HCL | Recombinant Human PRKD1 293 Cell Lysate | +Inquiry |
CLEC18C-7453HCL | Recombinant Human CLEC18C 293 Cell Lysate | +Inquiry |
TMEM43-950HCL | Recombinant Human TMEM43 293 Cell Lysate | +Inquiry |
IQCD-5179HCL | Recombinant Human IQCD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Hemigrapsus sanguineus Compound eye opsin BCRH1 Products
Required fields are marked with *
My Review for All Hemigrapsus sanguineus Compound eye opsin BCRH1 Products
Required fields are marked with *
0
Inquiry Basket