Recombinant Full Length Helicobacter Pylori 36 Kda Antigen (Hp_1488) Protein, His-Tagged
Cat.No. : | RFL25642HF |
Product Overview : | Recombinant Full Length Helicobacter pylori 36 kDa antigen (HP_1488) Protein (P94851) (1-329aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Helicobacter Pylori |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-329) |
Form : | Lyophilized powder |
AA Sequence : | MSNSMLDKNKAILTGGGALLLGLIVLFYLAYRPKAEVLQGFLEAREYSVSSKVPGRIEKV FVKKGDHIKKGDLVFSISSPELEAKLAQAEAGHKAAKALSDEVKRGSRDETINSARDVWQ AAKSQATLAKETYKRVQDLYDNGVASLQKRDEAYAAYESTKYNESAAYQKYKMALGGASS ESKIAAKAKESAALGQVNEVESYLKDVKATAPIDGEVSNVLLSGGELSPKGFPVVLMIDL KDSWLKISVPEKYLNEFKVGKEFEGYIPALKKSTKFRVKYLSVMGDFATWKATNNSNTYD MKSYEVEAIPLEELENFRVGMSVLVTIKP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HP_1488 |
Synonyms | HP_1488; 36 kDa antigen |
UniProt ID | P94851 |
◆ Recombinant Proteins | ||
KCNJ1A.2-2244Z | Recombinant Zebrafish KCNJ1A.2 | +Inquiry |
FAM185A-5549M | Recombinant Mouse FAM185A Protein | +Inquiry |
YPUD-3791B | Recombinant Bacillus subtilis YPUD protein, His-tagged | +Inquiry |
GCGR-2219H | Recombinant Human GCGR protein, His&Myc-tagged | +Inquiry |
RFL27085XF | Recombinant Full Length Xenopus Laevis Potassium Voltage-Gated Channel Subfamily Kqt Member 1(Kcnq1) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
Spinalcord-C57M | Native Mouse C57 Spinal cord protein | +Inquiry |
COL1A1-26195TH | Native Human COL1A1 | +Inquiry |
IBVF0406-225I | Native Influenza (B/Florida 04/06) IBVF0406 protein | +Inquiry |
Glycogen-006B | Native Bovine or Rabbit Glycogen | +Inquiry |
IgE-507H | Native Human IgE protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCAMP5-576HCL | Recombinant Human SCAMP5 lysate | +Inquiry |
FMN1-657HCL | Recombinant Human FMN1 cell lysate | +Inquiry |
CCDC124-7784HCL | Recombinant Human CCDC124 293 Cell Lysate | +Inquiry |
CD164-1257RCL | Recombinant Rat CD164 cell lysate | +Inquiry |
PTPMT1-1436HCL | Recombinant Human PTPMT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HP_1488 Products
Required fields are marked with *
My Review for All HP_1488 Products
Required fields are marked with *
0
Inquiry Basket