Recombinant Full Length Hahella Chejuensis Atp-Dependent Zinc Metalloprotease Ftsh(Ftsh) Protein, His-Tagged
Cat.No. : | RFL8193HF |
Product Overview : | Recombinant Full Length Hahella chejuensis ATP-dependent zinc metalloprotease FtsH(ftsH) Protein (Q2SF13) (1-619aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Hahella chejuensis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-619) |
Form : | Lyophilized powder |
AA Sequence : | MSNTDPQPPQKLPLNWVVWTLAVALMLYYLPAMRDRPEPAIKLPYSEFRMLLREGQISSV TLRGSELDGKFITPRMFPEQRRQYSRFLTQLPDFGNEAILAELEEQNIPLEVKEGHDASS SKVILLSYLPWIMFMIILFWLSRRTFRNFSGRGGAFDFDKRLETQFECQKPDTTFDEVAG QTNAKREVQELVEYLRDPDRFHRVGALAPRGVLLMGPPGTGKTLLARALAGEAGVNFYPM SASEFIEVFVGVGASRVRQLFKIAKENSPSIIFIDELDSVGRTRGAGYGGGHDEREQTLN QILAEMDGFAGHDAVIVLAATNRPDVLDPALMRPGRFDRHVTLDLPDQEGRVAILKVHAR HIPLADDVNLNQVAAGTPGFSGADLKNLINEAAIQAARENRDHVHSLDFDIARDKIIMGA ERTLIIPPDEKHRLAVHESGHTLVAYYLPNTDPLYKVSIVPHGRSLGGTHQLPLQERHTY PEEYLRDKLAVMLAGRIAERELLGSVSTGADDDIHQATGLARAMVSRWGMSKEVGPVDLR DSEEHPFLGREMAQPHHHSEFSAEIIDKAVRELLVAAETTAADLISTHREKLDRLVALLE RSETLHKAQIDECLQTGAS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ftsH |
Synonyms | ftsH; HCH_04046; ATP-dependent zinc metalloprotease FtsH |
UniProt ID | Q2SF13 |
◆ Recombinant Proteins | ||
PIGT-1711H | Recombinant Human PIGT, His-tagged | +Inquiry |
Granzyme A-49 | Active Recombinant Granzyme A Enzyme | +Inquiry |
KIF18A-4299C | Recombinant Chicken KIF18A | +Inquiry |
BMP16-329H | Recombinant Active Human BMP16 Protein, His-tagged(C-ter) | +Inquiry |
SLC15A2-0913H | Recombinant Human SLC15A2 Protein (N2-L729), 8×His-MBP, Flag tagged | +Inquiry |
◆ Native Proteins | ||
IgG-351C | Native Cat IgG | +Inquiry |
IgA-204M | Native Monkey Immunoglobulin A | +Inquiry |
NEFH-180B | Native bovine NEFH | +Inquiry |
IgG-514H | Native Human IgG | +Inquiry |
COL2A1-1647H | Native Human COL2A1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CTPS-7197HCL | Recombinant Human CTPS 293 Cell Lysate | +Inquiry |
Fetal Ovary -152H | Human Fetal Ovary Lysate | +Inquiry |
SLC3A2-2015HCL | Recombinant Human SLC3A2 cell lysate | +Inquiry |
MUT-4054HCL | Recombinant Human MUT 293 Cell Lysate | +Inquiry |
UBL4A-554HCL | Recombinant Human UBL4A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ftsH Products
Required fields are marked with *
My Review for All ftsH Products
Required fields are marked with *
0
Inquiry Basket