Recombinant Full Length Haemophilus Parasuis Serovar 5 Electron Transport Complex Protein Rnfa(Rnfa) Protein, His-Tagged
Cat.No. : | RFL986HF |
Product Overview : | Recombinant Full Length Haemophilus parasuis serovar 5 Electron transport complex protein RnfA(rnfA) Protein (B8F7B7) (1-193aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Haemophilus parasuis serovar 5 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-193) |
Form : | Lyophilized powder |
AA Sequence : | MVEYILLIISTALINNFVLVKFLGLCPFMGVSKKVETAIGMGMATTFVLTVASLSAYLVE TYLLIPLEAEFLRTLVFILVIAVIVQLTEMIVHKTSSALYRLLGIYLPLITTNCAVLGVA LLNVNLSNNLVQSVLYGFGAAAGFSLVLVLFSALRERLVAADVPRAFQGASIALITAGLM SLAFMGFTGLVKI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | rnfA |
Synonyms | rnfA; HAPS_1676; Ion-translocating oxidoreductase complex subunit A; Rnf electron transport complex subunit A |
UniProt ID | B8F7B7 |
◆ Recombinant Proteins | ||
DLX3-2405M | Recombinant Mouse DLX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Tmem70-6513M | Recombinant Mouse Tmem70 Protein, Myc/DDK-tagged | +Inquiry |
SLX4-15581M | Recombinant Mouse SLX4 Protein | +Inquiry |
RAB3A-3751R | Recombinant Rhesus monkey RAB3A Protein, His-tagged | +Inquiry |
Tbx5-2116M | Recombinant Mouse Tbx5 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Protein A-01S | Active Native Staphylococcus aureus Protein A | +Inquiry |
Lectin-1835R | Native Ricinus Communis Ricin A Chain Protein | +Inquiry |
Col4-20M | Native Mouse Collagen IV protein | +Inquiry |
F2-277B | Active Native Bovine α-Thrombin-BFPRck (Biotin) | +Inquiry |
C1q-04M | Native Mouse C1q Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HA-2311HCL | Recombinant H15N8 HA cell lysate | +Inquiry |
CHIC2-7537HCL | Recombinant Human CHIC2 293 Cell Lysate | +Inquiry |
TWSG1-1547MCL | Recombinant Mouse TWSG1 cell lysate | +Inquiry |
C14orf21-208HCL | Recombinant Human C14orf21 cell lysate | +Inquiry |
RBM19-1484HCL | Recombinant Human RBM19 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All rnfA Products
Required fields are marked with *
My Review for All rnfA Products
Required fields are marked with *
0
Inquiry Basket