Recombinant Full Length Haemophilus Influenzae Uncharacterized Protein Hi_1595 (Hi_1595) Protein, His-Tagged
Cat.No. : | RFL19391HF |
Product Overview : | Recombinant Full Length Haemophilus influenzae Uncharacterized protein HI_1595 (HI_1595) Protein (P44266) (1-107aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Haemophilus Influenzae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-107) |
Form : | Lyophilized powder |
AA Sequence : | MIKQITERFTPRQYLAEFLLGLTALFGLYLIVAWSSYTPLDNSWATVSAYGNTINKVGSF GAWIIDLFFVFLGYVAHIIPFTAFLVPIYLLKTKAVKQLSCTRIILR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HI_1595 |
Synonyms | HI_1595; Uncharacterized protein HI_1595 |
UniProt ID | P44266 |
◆ Recombinant Proteins | ||
CARM1-098H | Recombinant Human CARM1 Protein, GST-tagged | +Inquiry |
UBE2D2-645H | Active Recombinant Human UBE2D2 Protein, His-tagged | +Inquiry |
ORM1-287H | Recombinant Human ORM1 Protein, MYC/DDK-tagged | +Inquiry |
Csf1r-8666M | Recombinant Mouse Csf1r, Fc-His tagged | +Inquiry |
RFL10275PF | Recombinant Full Length Pongo Abelii Mitochondrial Uncoupling Protein 2(Ucp2) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
R-PE-004R | Native Red Fluorescent Protein | +Inquiry |
Lectin-1751A | Active Native Aleuria Aurantia Lectin Protein, Agarose bound | +Inquiry |
TTR-254H | Native Human Prealbumin | +Inquiry |
Adipose Tissue-001H | Human Adipose Tissue Lysate, Total Protein | +Inquiry |
APOB-26875TH | Native Human APOB | +Inquiry |
◆ Cell & Tissue Lysates | ||
METTL18-8177HCL | Recombinant Human C1orf156 293 Cell Lysate | +Inquiry |
KCT2-906HCL | Recombinant Human KCT2 cell lysate | +Inquiry |
CAMK2A-7881HCL | Recombinant Human CAMK2A 293 Cell Lysate | +Inquiry |
Ileum-444S | Sheep Ileum Lysate, Total Protein | +Inquiry |
HNMT-5455HCL | Recombinant Human HNMT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HI_1595 Products
Required fields are marked with *
My Review for All HI_1595 Products
Required fields are marked with *
0
Inquiry Basket