Recombinant Full Length Haemophilus Influenzae Uncharacterized Protein Hi_1298 (Hi_1298) Protein, His-Tagged
Cat.No. : | RFL1565HF |
Product Overview : | Recombinant Full Length Haemophilus influenzae Uncharacterized protein HI_1298 (HI_1298) Protein (P45146) (1-231aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Haemophilus Influenzae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-231) |
Form : | Lyophilized powder |
AA Sequence : | MQQYIIYLYTFLTIFGFWLALQISKRWKSMIFNTFVLTVLILAAILVIGKIPYDDYMAGN APINNLLGLSIVALALPLYEQLRQIARQWKIILSTVVIASFLAMLSGGLLALLLGSTPEM VATVLPKSITMPIAMEVSRHLGGIPAVTAVGVVVAGLQGSIFGYLVLKKLGVKHQEAIGL SVGSVSHALGTVSCMETNPTAGSYSSISLVLCGIISSILAPFVFKLIYFFV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HI_1298 |
Synonyms | HI_1298; Uncharacterized protein HI_1298 |
UniProt ID | P45146 |
◆ Recombinant Proteins | ||
RFL27500BF | Recombinant Full Length Bovine Keratinocyte-Associated Protein 2(Krtcap2) Protein, His-Tagged | +Inquiry |
CD80-137CAF488 | Recombinant Monkey CD80 Protein, hFc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
APOLD1-1536H | Recombinant Human APOLD1 Full Length Transmembrane protein, His-tagged | +Inquiry |
CLEC14A-1457H | Recombinant Human CLEC14A Protein, GST-tagged | +Inquiry |
FYCO1-6111M | Recombinant Mouse FYCO1 Protein | +Inquiry |
◆ Native Proteins | ||
Neuraminidase-007C | Active Native Clostridium perfringens Neuraminidase, Type X | +Inquiry |
Factor XIIa-66H | Native Human Factor XIIa | +Inquiry |
MHC-239H | Native Human Myosin Heavy Chain | +Inquiry |
Lectin-1774E | Active Native Erythrina Cristagalli Lectin Protein, Fluorescein labeled | +Inquiry |
VLDL-392H | Native Human Very Low Density Lipoprotein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDN-3934HCL | Recombinant Human NDN 293 Cell Lysate | +Inquiry |
ORMDL1-3548HCL | Recombinant Human ORMDL1 293 Cell Lysate | +Inquiry |
NNT-3778HCL | Recombinant Human NNT 293 Cell Lysate | +Inquiry |
MCF7-169H | MCF7 Whole Cell Lysate | +Inquiry |
MSMO1-575HCL | Recombinant Human MSMO1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All HI_1298 Products
Required fields are marked with *
My Review for All HI_1298 Products
Required fields are marked with *
0
Inquiry Basket