Recombinant Full Length Haemophilus Influenzae Uncharacterized Metalloprotease Hi_0409 (Hi_0409) Protein, His-Tagged
Cat.No. : | RFL33609HF |
Product Overview : | Recombinant Full Length Haemophilus influenzae Uncharacterized metalloprotease HI_0409 (HI_0409) Protein (P44693) (1-475aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Haemophilus Influenzae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-475) |
Form : | Lyophilized powder |
AA Sequence : | MPVQHVKLARDRRKKRAYIKVGVFFVAILLILTGILLTIKSKPEENSIFSTFDSGEYHEL NTSPNENSTALQPDENATSYDDELQAKDDEVDEVKLSSDDLDTLPQHAQDALNGLLDAAD QAIRITDQFSYTVTEGDTLKDVLVLSGLDDSSVQPLIALDPELAHLKAGQQFYWILDKND NLEYLNWLVSEKEERIYERLEDGKFKRQVIEKKSIWRKEVLKGEIQNSLNSSLREKGLDT RQISQLSNALQWQVSLRKLKKGTQFAILVSREYLGDKLTGQGNVEALRISSGGKNYYAVQ AANGRYYNQQGETLGKGFARYPLQRQARVSSPFNPNRRHPVTGRIRPHKGVDFSVSQGTP VIAPADGTVEKVAYQAGGAGRYVMLRHGREYQTVYMHLSKSLVKAGQTVKKGERIALSGN TGISTGPHLHYEFHINGRAVNPLTVKLPGTSSGMTSAERKQFLVRVREAERMLKP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HI_0409 |
Synonyms | HI_0409; Uncharacterized metalloprotease HI_0409 |
UniProt ID | P44693 |
◆ Native Proteins | ||
PAEP-04B | Native Bovine PAEP Protein | +Inquiry |
C7-102H | Active Native Human C7 Protein | +Inquiry |
TF-323H | Native Human Transferrin Fluorescein | +Inquiry |
AMY1A-5329H | Native Human Amylase, Alpha 1A (salivary) | +Inquiry |
Thrombin-26H | Active Native Human-Thrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
TRIM17-1823HCL | Recombinant Human TRIM17 cell lysate | +Inquiry |
EPOR & CD131-1943HCL | Recombinant Human EPOR & CD131 cell lysate | +Inquiry |
ZAP70-1948HCL | Recombinant Human ZAP70 cell lysate | +Inquiry |
TXNRD3IT1-616HCL | Recombinant Human TXNRD3IT1 293 Cell Lysate | +Inquiry |
PCBP4-3401HCL | Recombinant Human PCBP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HI_0409 Products
Required fields are marked with *
My Review for All HI_0409 Products
Required fields are marked with *
0
Inquiry Basket