Recombinant Full Length Haemophilus Influenzae Uncharacterized Abc Transporter Atp-Binding Protein Hi_0663 (Hi_0663) Protein, His-Tagged
Cat.No. : | RFL21603HF |
Product Overview : | Recombinant Full Length Haemophilus influenzae Uncharacterized ABC transporter ATP-binding protein HI_0663 (HI_0663) Protein (P71355) (1-560aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Haemophilus Influenzae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-560) |
Form : | Lyophilized powder |
AA Sequence : | MLWNWVALVGGIISAVVFSYILQAAYFHELSLLSAVILGIVLIAALALRAFAGKKSVQAS YFASTKVKHELRSLIYRKLASMPLNQVNQQSTSSIIQVASEGVEQLEIYFGRYLPQLFYS LLAPLTLFAFLIFFSFKTAIILLICVPLIPMSIIAVNKIAKKLLAKYWSIYVGLGSSFLD NLQGLITLKIYQDDAYKAKAMDKEAEHFRKITMKVLTMQLNSVSLMDLLAYGGAAIGILT ALLQFQNAQLSVLGVILFILLSSEFFIPLRLLGSFFHVAMNGKAASDKIFTLLDTPVETQ QSAVDFEAKNNVQVEIKDLHFSYSEEKPAITGLNLSILPNQLSVFVGKSGCGKSTLVSLL MGFNKAQQGEILFNGQNALNIDRTSFYQKVSLVSHSSYVFKGTLRENMTMAKIDATDEQI YACLEQVNLAQFVRDNGGLDMQLLSRGANLSGGQIQRLALARALLHNAELYIFDEATSNI DVESEEIILQFIQQFKQQKTIVMISHRLANAVNADCINVLDQGKLIEQGTHKELMEKQGA YAEMFQQQKDLEQIREVANA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HI_0663 |
Synonyms | HI_0663; Uncharacterized ABC transporter ATP-binding protein HI_0663 |
UniProt ID | P71355 |
◆ Native Proteins | ||
IgA-248A | Native Alpaca Immunoglobulin A | +Inquiry |
RBP-94H | Native Human Retinol-Binding Protein | +Inquiry |
Elastase-01H | Active Native Human Sputum Leucocyte Elastase | +Inquiry |
ORM1-5323H | Native Human Orosomucoid 1 | +Inquiry |
BGLAP-59B | Native Bovine Osteocalcin | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIST2H3A-5516HCL | Recombinant Human HIST2H3A 293 Cell Lysate | +Inquiry |
IL17F-2045HCL | Recombinant Human IL17F cell lysate | +Inquiry |
SLC33A1-1629HCL | Recombinant Human SLC33A1 cell lysate | +Inquiry |
SLC25A10-1785HCL | Recombinant Human SLC25A10 293 Cell Lysate | +Inquiry |
RGS4-2372HCL | Recombinant Human RGS4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HI_0663 Products
Required fields are marked with *
My Review for All HI_0663 Products
Required fields are marked with *
0
Inquiry Basket