Recombinant Full Length Haemophilus Influenzae Uncharacterized Abc Transporter Atp-Binding Protein Hi_0036(Hi_0036) Protein, His-Tagged
Cat.No. : | RFL24035HF |
Product Overview : | Recombinant Full Length Haemophilus influenzae Uncharacterized ABC transporter ATP-binding protein HI_0036(HI_0036) Protein (Q57335) (1-592aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Haemophilus Influenzae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-592) |
Form : | Lyophilized powder |
AA Sequence : | MDYSQEAITSLIWILQTLAITSVVFSFGIFLLVRFTQWGKQFWMFAGGYLSPKRSIKPIL FFLLIVAMTLLSVRISLVNSEWYKNMYTSLQEFNEHVFWQQMGLFCVIAASSVSAALVSY YLEQRFVINWIEWLNEQLVNKWMAHRAYYKTQYLSENLDNPDQRIQQDVQSYVKTTLSLS TGVIDAVTSMISYTILLWGLAGPMIVLGVEIPHMMVFLVFGYVIFTTLIAFWLGRPLISL NFINERLNANYRYSLIRIKEYAESIAFYAGEKVEKNQLYQQFNAVIHNMWVIIFRTLKFS GFNLVVSQISVVFPLLIQVGRYFEKQIKLGDLMQTLQVFGQLHANLSFFRSTYDNFASYK ATLDRLTGFCYAIEKANNKSQTQIHNHPTDVIFKNLSIQNPLGHTLIKHLNITLPQGTSL LIQGKSGAGKTTLLRTIAGLWSYAEGEINCPTHNQLFLSQKPYVPQGNLMSALAYPNNAD NISHTQAVEILNKVQLGHLAEQLEKEQDWTRILSLGEQQRLAFARLILHKPAVAFLDEAT ASMDEGLEFSMYQLLQQELPQTTIISVGHRSTLKTLHQQQLILQDKGQWQVL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HI_0036 |
Synonyms | HI_0036; Uncharacterized ABC transporter ATP-binding protein HI_0036 |
UniProt ID | Q57335 |
◆ Recombinant Proteins | ||
ROR1-7814H | Recombinant Human ROR1 protein, Avi-tagged | +Inquiry |
IL13-124H | Recombinant Human IL13 protein | +Inquiry |
RFL32796MF | Recombinant Full Length Mouse Orexin Receptor Type 1(Hcrtr1) Protein, His-Tagged | +Inquiry |
NRAS-1922C | Recombinant Chicken NRAS | +Inquiry |
Serpinb3c-3082M | Recombinant Mouse Serpinb3c protein(Met1-Pro386), His-tagged | +Inquiry |
◆ Native Proteins | ||
Ferritin-026H | Native Human Ferritin Protein, holo form | +Inquiry |
LN-2686M | Native Mouse LN Protein | +Inquiry |
GC-198H | Native Human GC-Globulin | +Inquiry |
HA-007R | Native Rooster comb Hyaluronic acid sodium salt | +Inquiry |
LOC100514666-45P | Native Porcine Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PROK1-001HCL | Recombinant Human PROK1 cell lysate | +Inquiry |
ZNF572-47HCL | Recombinant Human ZNF572 293 Cell Lysate | +Inquiry |
CASP6-7834HCL | Recombinant Human CASP6 293 Cell Lysate | +Inquiry |
FLJ12331-6193HCL | Recombinant Human FLJ12331 293 Cell Lysate | +Inquiry |
CD70-1303RCL | Recombinant Rat CD70 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HI_0036 Products
Required fields are marked with *
My Review for All HI_0036 Products
Required fields are marked with *
0
Inquiry Basket