Recombinant Full Length Haemophilus Influenzae Probable D-Methionine Transport System Permease Protein Meti(Meti) Protein, His-Tagged
Cat.No. : | RFL569HF |
Product Overview : | Recombinant Full Length Haemophilus influenzae Probable D-methionine transport system permease protein metI(metI) Protein (P46492) (1-213aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Haemophilus Influenzae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-213) |
Form : | Lyophilized powder |
AA Sequence : | MWGVVATATYETVYISFASTLLAVLVGVPVGIWTFLTGKNEILQNNRTHFVLNTIINIGR SIPFIILLLILLPVTRFIVGTVLGTTAAIIPLSICAMPFVARLTANALMEIPNGLTEAAQ AMGATKWQIVRKFYLSEALPTLINGVTLTLVTLVGYSAMAGTQGGGGLGSLAINYGRIRN MPYVTWVATIIIVLFVMISQKLGDTLAKKVDHR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | metI |
Synonyms | metI; HI_0620.1; Probable D-methionine transport system permease protein MetI |
UniProt ID | P46492 |
◆ Recombinant Proteins | ||
SCO0757-1381S | Recombinant Streptomyces coelicolor A3(2) SCO0757 protein, His-tagged | +Inquiry |
IL11-4299H | Recombinant Human IL11 Protein (Met1-Leu199), C-His tagged | +Inquiry |
CD24-5743H | Recombinant Human CD24 protein, mFc-tagged, Biotinylated(Primary Amine Labeling) | +Inquiry |
Tnfsf10-6550M | Active Recombinant Mouse Tnfsf10 Protein | +Inquiry |
HUWE1-14016H | Recombinant Human HUWE1, GST-tagged | +Inquiry |
◆ Native Proteins | ||
FGB-40B | Native Bovine Fibrinogen, FITC Labeled | +Inquiry |
ABL1-618H | Native Human C-abl Oncogene 1, Receptor Tyrosine Kinase | +Inquiry |
RV-17 | Native Rotavirus Antigen | +Inquiry |
ACTB-325H | Active Native Human ACTB | +Inquiry |
Prothrombin-270B | Active Native Bovine Prothrombin | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP14-4279HCL | Recombinant Human MMP14 293 Cell Lysate | +Inquiry |
Temporal Lobe-505H | Human Temporal Lobe (Alzheimers Disease) Membrane Lysate | +Inquiry |
ESF1-575HCL | Recombinant Human ESF1 cell lysate | +Inquiry |
ACVRL1-1191CCL | Recombinant Cynomolgus ACVRL1 cell lysate | +Inquiry |
LDHAL6B-4789HCL | Recombinant Human LDHAL6B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All metI Products
Required fields are marked with *
My Review for All metI Products
Required fields are marked with *
0
Inquiry Basket