Recombinant Full Length Haemophilus Influenzae Heme Exporter Protein D(Ccmd) Protein, His-Tagged
Cat.No. : | RFL16870HF |
Product Overview : | Recombinant Full Length Haemophilus influenzae Heme exporter protein D(ccmD) Protein (P45035) (1-67aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Haemophilus Influenzae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-67) |
Form : | Lyophilized powder |
AA Sequence : | MFFQTWSDFFNMGGYGFYVWLSYAVSLVAVIALIVQSVKQRKTVLQNVLREKQREERLQQ ANKGNTL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ccmD |
Synonyms | ccmD; HI_1092; Heme exporter protein D; Cytochrome c-type biogenesis protein CcmD |
UniProt ID | P45035 |
◆ Native Proteins | ||
IGHD -20H | Native Human IgD | +Inquiry |
THBD-306R | Active Native Rabbit Lung Thrombomodulin | +Inquiry |
Lectin-1823P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein, Biotinylated | +Inquiry |
UO-44 | Active Native Urate oxidase | +Inquiry |
ApoA-II-3555H | Native Human ApoA-II | +Inquiry |
◆ Cell & Tissue Lysates | ||
AOC2-8823HCL | Recombinant Human AOC2 293 Cell Lysate | +Inquiry |
FBXO39-6296HCL | Recombinant Human FBXO39 293 Cell Lysate | +Inquiry |
Colon-90B | Bovine Colon Lysate | +Inquiry |
TP73-AS1-4974HCL | Recombinant Human KIAA0495 293 Cell Lysate | +Inquiry |
FGA-618HCL | Recombinant Human FGA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ccmD Products
Required fields are marked with *
My Review for All ccmD Products
Required fields are marked with *
0
Inquiry Basket