Recombinant Full Length Haemophilus Influenzae Atp-Binding/Permease Protein Cydd(Cydd) Protein, His-Tagged
Cat.No. : | RFL4912HF |
Product Overview : | Recombinant Full Length Haemophilus influenzae ATP-binding/permease protein CydD(cydD) Protein (P45082) (1-586aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Haemophilus Influenzae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-586) |
Form : | Lyophilized powder |
AA Sequence : | MNKLRQKYLQKWLRAQQEPIKKLMRANIVLATLSSFILVAQTYFLATLLDKLIMQNVPRD ELIPYFLGLIIGFGMRAIILWAREKIGFQSGQLLRNHIRQKILDKIHLVGPATINQKPAG SWASIMLEQVENLHNFYARFLPQQSLSAIVPVVIFIAVFPLNWAAGLILMITAPLVPLFM IIVGIAAADNSQKNMDTLSRLSAQFLDRLRGLETLRLFNRTSEQTEHIENATEDFRETTM DVLKLAFLSSAVLEFFTSISIALMAVYFGFSYLGQIEFGTYNAPLTLFTGFFCLILAPEF YQPLRDLGTYYHDRAAGIGAADAIVDFLESDYLTVHQNEKTISLESAVEISAENLVVLST QGSALTKPLNFQIPANHNVALVGQSGAGKTSLMNVILGFLPYEGSLKINGQELRESNLAD WRKHIAWVGQNPLLLQGTIKENLLLGDVQANDEEINQALMRSQAKEFTDKLGLHHEIKDG GLGISVGQAQRLAIARALLRKGDLLLLDEPTASLDAQSENLVLQALNEASQHQTTLMITH RIEDLKQCDQIFVMQRGEIVQQGKFTELQHEGFFAELLAQRQQDIQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | cydD |
Synonyms | cydD; HI_1157; ATP-binding/permease protein CydD |
UniProt ID | P45082 |
◆ Native Proteins | ||
CGA-1855H | Native Human, Glycoprotein Hormones, Alpha Polypeptide | +Inquiry |
Prothrombin-4S | Native Snake E. Carinatus Viper Venom Prothrombin Activator | +Inquiry |
KNG1-1844H | Native Human Kininogen 1 | +Inquiry |
ORM1-110H | Native Human Alpha 1 Acid Glycoprotein (A1AGP) | +Inquiry |
SAA-152H | Native Human Serum Amyloid A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
YAF2-1943HCL | Recombinant Human YAF2 cell lysate | +Inquiry |
IFNAR2-2243HCL | Recombinant Human IFNAR2 cell lysate | +Inquiry |
Heart Ventricle-222H | Human Heart Ventricle (RT) (Diseased) Lysate | +Inquiry |
MSH6-4117HCL | Recombinant Human MSH6 293 Cell Lysate | +Inquiry |
CRADD-7294HCL | Recombinant Human CRADD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All cydD Products
Required fields are marked with *
My Review for All cydD Products
Required fields are marked with *
0
Inquiry Basket