Recombinant Full Length Haemophilus Ducreyi Na(+)-Translocating Nadh-Quinone Reductase Subunit C(Nqrc) Protein, His-Tagged
Cat.No. : | RFL10248HF |
Product Overview : | Recombinant Full Length Haemophilus ducreyi Na(+)-translocating NADH-quinone reductase subunit C(nqrC) Protein (Q7VNU7) (1-257aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Haemophilus ducreyi |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-257) |
Form : | Lyophilized powder |
AA Sequence : | MAKFNKDSVSGTLTVVVLLSLICSLIVASAAVLLKPTQDIQKQLDKQKNILQAAGLMHEN TNVQETYAKFIEPKIVDLATGDYVEDVANFDAKAFAKDPATSVAIKPEDDKANIRMRAKY AEVYLVKDEMGQTTQVVLPMYGNGLWSMMYGFVAVQPDANTVNGITYYEQGETAGLGGEI ANPNWQKSFVGKKLFNANNEVALTIGKGASADKEHGVDGLSGATLTSKGVDNSFKYWFGT NGFGPYLAKFKATAGAN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nqrC |
Synonyms | nqrC; HD_0381; Na(+-translocating NADH-quinone reductase subunit C; Na(+-NQR subunit C; Na(+-translocating NQR subunit C; NQR complex subunit C; NQR-1 subunit C |
UniProt ID | Q7VNU7 |
◆ Recombinant Proteins | ||
PC221-P3-0093S | Recombinant Staphylococcus aureus PC221_P3 protein, His-tagged | +Inquiry |
RFL11207YF | Recombinant Full Length Yersinia Pseudotuberculosis Serotype O:1B Electron Transport Complex Protein Rnfa(Rnfa) Protein, His-Tagged | +Inquiry |
NDUFB5-681H | Recombinant Human NDUFB5 Protein (94-189 aa), His-SUMO-tagged | +Inquiry |
SCIN-14748M | Recombinant Mouse SCIN Protein | +Inquiry |
FAM153A-1442H | Recombinant Human FAM153A | +Inquiry |
◆ Native Proteins | ||
APOA2-5302H | Native Human Apolipoprotein A-II | +Inquiry |
FGG-7H | Native Human Fibrinogen, FITC Labeled | +Inquiry |
PROC-273B | Active Native Bovine Protein C - DEGR (active site blocked) | +Inquiry |
TNNI1-49H | Native Human troponin I type 1 Protein | +Inquiry |
AMY1A-5329H | Native Human Amylase, Alpha 1A (salivary) | +Inquiry |
◆ Cell & Tissue Lysates | ||
ESF1-575HCL | Recombinant Human ESF1 cell lysate | +Inquiry |
CIDEA-358HCL | Recombinant Human CIDEA cell lysate | +Inquiry |
DBP-7062HCL | Recombinant Human DBP 293 Cell Lysate | +Inquiry |
SLFNL1-1684HCL | Recombinant Human SLFNL1 293 Cell Lysate | +Inquiry |
KPTN-4886HCL | Recombinant Human KPTN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All nqrC Products
Required fields are marked with *
My Review for All nqrC Products
Required fields are marked with *
0
Inquiry Basket