Recombinant Full Length Guinea Pig T-Cell Surface Glycoprotein Cd1E, Membrane-Associated(Cd1E) Protein, His-Tagged
Cat.No. : | RFL29791CF |
Product Overview : | Recombinant Full Length Guinea pig T-cell surface glycoprotein CD1e, membrane-associated(CD1E) Protein (Q9QZY5) (34-390aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Guinea pig |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (34-390) |
Form : | Lyophilized powder |
AA Sequence : | EEPLIFRLLHIASFKNHSWSHSQASAWIGDLQTHGWNSTMGTIQFLKPWSQGDFSKEELK NFEALFRLYFHDFPREVHAFAHQFQFEYPFELQISGGCKNVGKTSENFLNGAYQGSDLLS FQRSSWEPSPGAGSRAQKVCEVLSYYKDITEIVQSLLSSVCPRFLSGLIAAGKSELERQV KPEVWLSRGPSPGRGRLQLVCHVSGFHPKPVWVMWMKGQQEQKGTKTGDIPNADETWYLQ ATLDVAEREATGLSCRVKHSSLGGHDIIIHWGGYSILLILMYVAVIVTLVTLIVMGSWHR KQSSNRNVLSSYISNPTFPLENDTQCPRSSALQLHSAQESWIKNRILKWKRSLNQFW |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CD1E |
Synonyms | CD1E; T-cell surface glycoprotein CD1e, membrane-associated; mCD1e; CD antigen CD1e |
UniProt ID | Q9QZY5 |
◆ Recombinant Proteins | ||
CD1E-551R | Recombinant Rhesus Macaque CD1E Protein, His (Fc)-Avi-tagged | +Inquiry |
CD1E & B2M-197C | Recombinant Cynomolgus CD1E & B2M protein, His-tagged | +Inquiry |
CD1E-724R | Recombinant Rhesus monkey CD1E Protein, His-tagged | +Inquiry |
CD1E-151H | Recombinant Human CD1E Protein, His-tagged | +Inquiry |
CD1E-512H | Recombinant Human CD1e molecule, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD1E-7681HCL | Recombinant Human CD1E 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD1E Products
Required fields are marked with *
My Review for All CD1E Products
Required fields are marked with *
0
Inquiry Basket