Recombinant Full Length Guinea Pig T-Cell Surface Glycoprotein Cd1E, Membrane-Associated(Cd1E) Protein, His-Tagged

• Cat.No.: RFL29791CF
• Product Overview: Recombinant Full Length Guinea pig T-cell surface glycoprotein CD1e, membrane-associated(CD1E) Protein (Q9QZY5) (34-390aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Source: E.coli expression system
• Species: Cavia porcellus (Guinea pig)
• Tag: His
• Form: Lyophilized powder
• Protein length: Full Length of Mature Protein (34-390)
• AA Sequence: EEPLIFRLLHIASFKNHSWSHSQASAWIGDLQTHGWNSTMGTIQFLKPWSQGDFSKEELK NFEALFRLYFHDFPREVHAFAHQFQFEYPFELQISGGCKNVGKTSENFLNGAYQGSDLLS FQRSSWEPSPGAGSRAQKVCEVLSYYKDITEIVQSLLSSVCPRFLSGLIAAGKSELERQV KPEVWLSRGPSPGRGRLQLVCHVSGFHPKPVWVMWMKGQQEQKGTKTGDIPNADETWYLQ ATLDVAEREATGLSCRVKHSSLGGHDIIIHWGGYSILLILMYVAVIVTLVTLIVMGSWHR KQSSNRNVLSSYISNPTFPLENDTQCPRSSALQLHSAQESWIKNRILKWKRSLNQFW
• Purity: Greater than 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: CD1E
• Synonyms: CD1E; T-cell surface glycoprotein CD1e, membrane-associated; mCD1e; CD antigen CD1e
• UniProt ID: Q9QZY5