Recombinant Full Length Guinea Pig Substance-P Receptor(Tacr1) Protein, His-Tagged
Cat.No. : | RFL8485CF |
Product Overview : | Recombinant Full Length Guinea pig Substance-P receptor(TACR1) Protein (P30547) (1-407aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Guinea pig |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-407) |
Form : | Lyophilized powder |
AA Sequence : | MDNVLPVDSDLFPNISTNTSEPNQFVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWIILAH KRMRTVTNYFLVNLAFAEASMAAFNTVVNFTYAVHNEWYYGLFYCKFHNFFPIAAVFASI YSMTAVAFDRYMAIIHPLQPRLSATATKVVICVIWVLALLLAFPQGYYSTTETMPGRVVC MIEWPSHPDKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQV SAKRKVVKMMIVVVCTFAICWLPFHIFFLLPYINPDLYLKKFIQQVYLAIMWLAMSSTMY NPIIYCCLNDRFRLGFKHAFRCCPFISAADYEGLEMKSTRYFQTQGSVYKVSRLETTIST VVGAHEEDPEEGPKATPSSLDLTSNGSSRSNSKTVTESSSFYSNMLS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | TACR1 |
Synonyms | TACR1; TAC1R; Substance-P receptor; SPR; NK-1 receptor; NK-1R; Tachykinin receptor 1 |
UniProt ID | P30547 |
◆ Recombinant Proteins | ||
ANKRD34B-549M | Recombinant Mouse ANKRD34B Protein, His (Fc)-Avi-tagged | +Inquiry |
Psme4-229M | Recombinant Mouse Psme4 Protein, MYC/DDK-tagged | +Inquiry |
POC1A-3963H | Recombinant Human POC1A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
UMPS-4917R | Recombinant Rhesus Macaque UMPS Protein, His (Fc)-Avi-tagged | +Inquiry |
MSTN-1104C | Recombinant Chicken MSTN | +Inquiry |
◆ Native Proteins | ||
PYGB-03H | Native Human PYGB Protein | +Inquiry |
A2m-367M | Native Mouse Alpha-2-Macroglobulin | +Inquiry |
FABP3-42H | Native Human FABP3 | +Inquiry |
F10-290M | Active Native Mouse Factor X | +Inquiry |
C.Pneumoniae-32 | Native Chlamydia pneumoniae Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACTL7B-9058HCL | Recombinant Human ACTL7B 293 Cell Lysate | +Inquiry |
TNFRSF1B-2632HCL | Recombinant Human TNFRSF1B cell lysate | +Inquiry |
HA-2661HCL | Recombinant H1N1 HA cell lysate | +Inquiry |
MIF-1917HCL | Recombinant Human MIF cell lysate | +Inquiry |
CD5-2572HCL | Recombinant Human CD5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TACR1 Products
Required fields are marked with *
My Review for All TACR1 Products
Required fields are marked with *
0
Inquiry Basket