Recombinant Full Length Guinea Pig Adenosine Receptor A2A(Adora2A) Protein, His-Tagged
Cat.No. : | RFL-28426CF |
Product Overview : | Recombinant Full Length Guinea pig Adenosine receptor A2a(ADORA2A) Protein (P46616) (1-409aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Guinea pig |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-409) |
Form : | Lyophilized powder |
AA Sequence : | MSSSVYITVELVIAVLAILGNVLVCWAVWINSNLQNVTNYFVVSLAAADIAVGVLAIPFA ITISTGFCAACHGCLFFACFVLVLTQSSIFSLLTITIDRYIAIRIPLRYNGLVTCTRAKG IIAICWVLSFAIGLTPMLGWNNCSQPKGDKNHSESCDEGQVTCLFEDVVPMNYMVYYNFF AFVLVPLLLMLGIYLRIFLAARRQLKQMESQPLPGERTRSTLQKEVHPAKSLAIIVGLFA LCCLPLNIINCFTFFCPECDHAPPWLMYLTIILSHGNSVVNPLIYAYRIREFRQTFRKII RSHILRRRELFKAGGTSARASAAHSPEGEQVSLRLNGHPPGVWANGSALRPEQRPNGYVL GLVSGRSAQRSHGDASLSDVELLSHEHKGTCPESPSLEDPPAHGGAGVS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ADORA2A |
Synonyms | ADORA2A; Adenosine receptor A2a |
UniProt ID | P46616 |
◆ Recombinant Proteins | ||
ADORA2A-2435H | Recombinant Human ADORA2A Protein, His (Fc)-Avi-tagged | +Inquiry |
ADORA2A-0964H | Recombinant Human ADORA2A Protein (S6-A316, N154A), 10×His tagged | +Inquiry |
ADORA2A-3960H | Active Recombinant Human ADORA2A Full Length Transmembrane protein, His-tagged(Nanodisc) | +Inquiry |
ADORA2A-87H | Recombinant Human ADORA2A Protein, His-tagged | +Inquiry |
RFL27954MF | Recombinant Full Length Mouse Adenosine Receptor A2A(Adora2A) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADORA2A-33HCL | Recombinant Human ADORA2A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADORA2A Products
Required fields are marked with *
My Review for All ADORA2A Products
Required fields are marked with *
0
Inquiry Basket