Recombinant Full Length Guillardia Theta Atp-Dependent Zinc Metalloprotease Ftsh(Ftsh) Protein, His-Tagged
Cat.No. : | RFL36509GF |
Product Overview : | Recombinant Full Length Guillardia theta ATP-dependent zinc metalloprotease FtsH(ftsH) Protein (O78516) (1-631aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Guillardia theta (Cryptomonas phi) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-631) |
Form : | Lyophilized powder |
AA Sequence : | MKISWKNILLTLIPLGLISFLVWQGFNNTTNPQFTKNIASSRMTYGRFLEYLDLGWVKKV DLYDEGHTAIVEAIGPELGNRIQRIRVELPATAPELITKLRKANVDLDAHATNDSTPAWS LIGNLIFPILLIAGLAFLFRRSSNLPGGPGQAMNFGKSKARFQMEAKTGVTFNDVAGVDE AKEEFEEVVSFLKKPERFTAVGAKIPKGVLLVGPPGTGKTLLAKAIAGEAGVPFFSISGS EFVEMFVGVGASRVRDLFKKAKENSPCIVFIDEIDAVGRQRGTGIGGGNDEREQTLNQLL TEMDGFEGNTGIIIIAATNRVDVLDAALLRPGRFDRQVTVDVPDVKGRLEILNVHARNKK LDLSISLELIAKRTPGFSGADLANLLNEAAILTARRRKKQITISEIDASIDRVIAGMEGK ALVDSKTKRLIAYHEVGHAIIGTLLKHHDPVQKVTLVPRGQAKGLTWFTPSEDQSLISRS QILARIMGALGGRAAEEVVFGLPEVTTGAGNDLQQVTSMARQMVTRFGMSNIGPLSLESQ NSDPFLGRTMGSSSQYSEDIASRIDMQVRAIIQHCHTETVQIIKDNRVVIDKLVDLLIEK ETIDGDEFRQIVGDFTSLPEKIDYKSQLKST |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ftsH |
Synonyms | ftsH; ycf25; ATP-dependent zinc metalloprotease FtsH |
UniProt ID | O78516 |
◆ Recombinant Proteins | ||
RFL31181SF | Recombinant Full Length Synechococcus Sp. Atp Synthase Subunit A(Atpb) Protein, His-Tagged | +Inquiry |
C12orf76-625H | Recombinant Human C12orf76 Protein, His-tagged | +Inquiry |
Il13-1661R | Recombinant Rat Il13 Protein, His-tagged | +Inquiry |
LSM1-331H | Recombinant Human LSM1 protein(Met1-Tyr133), His-tagged | +Inquiry |
SPRR1A-4139H | Recombinant Human SPRR1A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
KLKB1-27924TH | Native Human KLKB1 | +Inquiry |
Urease-52J | Active Native Jack Bean Urease | +Inquiry |
HDL-398H | Native Human High Density Lipoprotein, DiO labeled | +Inquiry |
Lectin-1837S | Active Native Sambucus Nigra Lectin Protein, Agarose bound | +Inquiry |
ACTA1-854P | Native Porcine ACTA1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HA-1844HCL | Recombinant H5N2 HA cell lysate | +Inquiry |
CDH1-938HCL | Recombinant Human CDH1 cell lysate | +Inquiry |
L3MBTL2-373HCL | Recombinant Human L3MBTL2 lysate | +Inquiry |
ALDH1A3-8919HCL | Recombinant Human ALDH1A3 293 Cell Lysate | +Inquiry |
CPA4-7320HCL | Recombinant Human CPA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ftsH Products
Required fields are marked with *
My Review for All ftsH Products
Required fields are marked with *
0
Inquiry Basket