Recombinant Full Length Grapevine Leafroll-Associated Virus 3 Protein P55 (Orf5) Protein, His-Tagged
Cat.No. : | RFL22234GF |
Product Overview : | Recombinant Full Length Grapevine leafroll-associated virus 3 Protein P55 (ORF5) Protein (O41517) (1-483aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Grapevine leafroll-associated virus 3 (isolate United States/NY1) (GLRaV-3) (Grapevine leafroll-associated closterovirus (isolate 109)) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-483) |
Form : | Lyophilized powder |
AA Sequence : | MDKYIYVTGILNPNEARDEVFSVVNKGYIGPGGRSFSNRGSKYTVVWENSAARISGFTST SQSTIDAFAYFLLKGGLTTTLSNPINCENWVRSSKDLSAFFRTLIKGKIYASRSVDSNLP KKDRDDIMEASRRLSPSDAAFCRAVSVQVGKYVDVTQNLESTIVPLRVMEIKKRRGSAHV SLPKVVSAYVDFYTNLQELLSDEVTRARTDTVSAYATDSMAFLVKMLPLTAREQWLKDVL GYLLVRRRPANFSYDVRVAWVYDVIATLKLVIRLFFNKDTPGGIKDLKPCVPIESFDPFH ELSSYFSRLSYEMTTGKGGKICPEIAEKLVRRLMEENYKLRLTPVMALIIILVYYSIYGT NATRIKRRPDFLNVRIKGRVEKVSLRGVEDRAFRISEKRGINAQRVLCRYYSDLTCLARR HYGIRRNNWKTLSYVDGTLAYDTADCITSKVRNTINTADHASIIHYIKTNENQVTGTTLP HQL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ORF5 |
Synonyms | ORF5; Protein P55 |
UniProt ID | O41517 |
◆ Recombinant Proteins | ||
GON4L-2274R | Recombinant Rat GON4L Protein, His (Fc)-Avi-tagged | +Inquiry |
VPS33B-6543R | Recombinant Rat VPS33B Protein | +Inquiry |
KCNMB4-274H | Recombinant Human KCNMB4, GST-tagged | +Inquiry |
RFL31091HF | Recombinant Full Length Human Transmembrane Protein 60(Tmem60) Protein, His-Tagged | +Inquiry |
HIST1H3F-7681M | Recombinant Mouse HIST1H3F Protein | +Inquiry |
◆ Native Proteins | ||
APCS-31189TH | Native Human APCS | +Inquiry |
PRF1-55H | Native Human Perforin | +Inquiry |
SV40gp6-268 | Active Native Simian virus 40 SV40gp6 protein | +Inquiry |
SERPINE1-29522TH | Native Human SERPINE1 | +Inquiry |
GG-185R | Native Rabbit Gamma Globulin protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
POLR1B-3042HCL | Recombinant Human POLR1B 293 Cell Lysate | +Inquiry |
AVPI1-8558HCL | Recombinant Human AVPI1 293 Cell Lysate | +Inquiry |
ARL5B-8709HCL | Recombinant Human ARL5B 293 Cell Lysate | +Inquiry |
PITX2-3165HCL | Recombinant Human PITX2 293 Cell Lysate | +Inquiry |
JAK3-5106HCL | Recombinant Human JAK3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ORF5 Products
Required fields are marked with *
My Review for All ORF5 Products
Required fields are marked with *
0
Inquiry Basket