Recombinant Full Length Glutamate Transport System Permease Protein Glud(Glud) Protein, His-Tagged
Cat.No. : | RFL30212CF |
Product Overview : | Recombinant Full Length Glutamate transport system permease protein gluD(gluD) Protein (Q8RQL4) (1-277aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Corynebacterium efficiens |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-277) |
Form : | Lyophilized powder |
AA Sequence : | MGSVLQENGQLDGDKWTPFLDPQTWTTYLLPGLWGTLKAAVASILLALIMGTLLGLGRIS EIRLLRWFCGIIIETFRAIPVLILMIFAYQLFARYQLVPSRQLAFAAVVFGLTMYNGSVI AEILRSGIASLPKGQREAAIALGMSTRQTTWSILLPQAVAAMLPALIAQMVIALKDSALG YQIGYIEVVRSGIQSASVNRNYLAALAVVAVIMILINFALTALAERIQRQLRAGRARRNI VAKVPEEPDQGLDTKDNVNVDWHDPDYKEVKHPGPSF |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | gluD |
Synonyms | gluD; CE1847; Glutamate transport system permease protein GluD |
UniProt ID | Q8RQL4 |
◆ Recombinant Proteins | ||
PLAC9-1299H | Recombinant Human PLAC9 protein(Met1-Phe97), mFc-tagged | +Inquiry |
Pre-M-10W | Recombinant West Nile Virus Pre-M Protein, C-6×His tagged | +Inquiry |
GAN-3463M | Recombinant Mouse GAN Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL7763PF | Recombinant Full Length Pongo Pygmaeus Histamine H1 Receptor(Hrh1) Protein, His-Tagged | +Inquiry |
EDF1-3052H | Recombinant Human EDF1 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Apotransferrin-37D | Native dog Apotransferrin | +Inquiry |
GCKR-8324S | Native S. cerevisiae GCKR | +Inquiry |
KRT19-169H | Native Human Cytokeratin 19 | +Inquiry |
FGA-55R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
Lectin-1818P | Active Native Peanut Lectin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF512-751HCL | Recombinant Human ZNF512 lysate | +Inquiry |
RPL23AP82-4332HCL | Recombinant Human MGC70863 293 Cell Lysate | +Inquiry |
ABCE1-9145HCL | Recombinant Human ABCE1 293 Cell Lysate | +Inquiry |
LRRC57-1033HCL | Recombinant Human LRRC57 cell lysate | +Inquiry |
ZNF596-39HCL | Recombinant Human ZNF596 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All gluD Products
Required fields are marked with *
My Review for All gluD Products
Required fields are marked with *
0
Inquiry Basket