Recombinant Full Length Gibberella Zeae Palmitoyltransferase Pfa4(Pfa4) Protein, His-Tagged
Cat.No. : | RFL8754GF |
Product Overview : | Recombinant Full Length Gibberella zeae Palmitoyltransferase PFA4(PFA4) Protein (Q4IMZ7) (1-437aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Gibberella zeae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-437) |
Form : | Lyophilized powder |
AA Sequence : | MAGLNDVPFIKGLAVPSVCALIIFLGYASQFLFNYSTTLEPGPPTRRETIIFNGLLLVLW ITYYRTVATDPGRYIFKDRVIEAEGQRWCNKCAAPKPPRAHHCRHCARCVPRMDHHCPWT RNCVSMTTFPHFLRFLIYTNMSLWMLGYFLWQRFSKIWEHRRLPAYLGPSFYGLICLSLI SIVNFVTTVALGIMLINTVKSWVFNQTMIEGWEQERHEALMDKGPKEWWDIMGPDGEKVR FERLEFPYDIGFFSNMAQAMGTHNVLLWFFPFAGNPTVAKDGNGQGWTWEENGFNRIEGL WPPPDPDKLRRAARGWPAGNRNYAEELRQANMSSSEYKAGFLKRQADDEKRKRHLMAELE EVDDFDMYDDEEYDRELDQGLGWVNSDGDRLRDYGVDEEASEPEGVNDDDDDDDDDDVPL AELIRRRKILKKDGLDD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PFA4 |
Synonyms | PFA4; FGRRES_01411; FGSG_01411; Palmitoyltransferase PFA4; Protein S-acyltransferase; PAT; Protein fatty acyltransferase 4 |
UniProt ID | Q4IMZ7 |
◆ Recombinant Proteins | ||
GSK3B16524H | Recombinant Human GSK3 ß (27-393) Protein | +Inquiry |
Nme4-1763M | Recombinant Mouse Nme4 protein, His & T7-tagged | +Inquiry |
PSA268-015-3351S | Recombinant Staphylococcus aureus (strain: SA268) PSA268_015 protein, His-tagged | +Inquiry |
RFL17536MF | Recombinant Full Length Mouse Brain Protein 44-Like Protein(Brp44L) Protein, His-Tagged | +Inquiry |
SAP18-4071R | Recombinant Rhesus monkey SAP18 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1835R | Native Ricinus Communis Ricin A Chain Protein | +Inquiry |
Lectin-1742W | Active Native Wisteria Floribunda Lectin Protein | +Inquiry |
Immunoglobulin M-85H | Native Human Immunoglobulin M | +Inquiry |
COL1-119H | Native Human COL1 protein, Biotinylated | +Inquiry |
dnt-142B | Active Native Bordetella bronchiseptica Dermonecrotic Toxin | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF329-94HCL | Recombinant Human ZNF329 293 Cell Lysate | +Inquiry |
PRTN3-2797HCL | Recombinant Human PRTN3 293 Cell Lysate | +Inquiry |
DCBLD2-868HCL | Recombinant Human DCBLD2 cell lysate | +Inquiry |
CYB5B-7145HCL | Recombinant Human CYB5B 293 Cell Lysate | +Inquiry |
HLA-DPB1-5505HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PFA4 Products
Required fields are marked with *
My Review for All PFA4 Products
Required fields are marked with *
0
Inquiry Basket